KEGG   Cyprinus carpio (common carp): 109096351
Entry
109096351         CDS       T05134                                 

Definition
(RefSeq) AF4/FMR2 family member 3-like
  KO
K15195  AF4/FMR2 family member 3
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccar03021]
    109096351
Transcription machinery [BR:ccar03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109096351
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 109096351
NCBI-ProteinID: XP_018965520
Position
18
AA seq 1129 aa
MPTIHGSKGKLARVCFMLHHASQDMTHSWPYQQPPGEGGTQHFLYSHAKEGKQPNSHHRH
VRDGVSMRMPSRPLVAPHKSMLADDLKLSSDEDDKDEGSERTTSWADNDRLSGQQQHRQQ
QHRTHTHVGRVRHSSSGSSGSDPSSEWESSSQRSHSPSPGTHNRCGTPTQHRTLNCSTET
ESPPSTQWQLDRWLEKVPKNHHSSDHDPGGGQRRSAKSDCGRGPSPGRYWSRDSESRRDY
SPCESPVPSPKFDYSPRNSPHPSPEYSPCPSPGISLVPSPVPSVCPSPGDSLQGSRSPSP
LPLHPPRSPSPSLSSTAVPSQGTYPQVQPPQKESPRHIARPTVTSNPAHHPKVRPWVPLD
HSANQRKEFRPKDSRSRDSRSKDSRPGPPQQPHHSEHNSTEKSHKDLTHKPEAKNSETTC
KQRFNSPSNPISKHLSKQRPSVSPKPQARHSSTTDHSIEHNHRSNEPTGVSIHSSHSKSG
HSSHFNTLKSSERGPSSKSRDSSRSEVNSRSSHSLKTKSFPDTKQSISKQTSQQSSSPKP
KVKLGDAPVPRTGHSQKDPKPREREREVDNRGKAQGATLVQTSKEQRQRLAEEQVIRRRW
VRSSEEEEDEEDRRTEEGERERKRRRRREQEVEWKAVQPKQRPHTNSQHHAQKEYNGLNL
EEQRRKKRRWNNEDISSGPHVTDTSLSPPLSPPSPTPVIKPTRPSSSSSSSSSSSSSSSS
SSSESDSESSPPRNVAKFPADSTSNQKTVSKRSNDKQTSGTGAHPHGSSLSTPETDKQGR
GRHKLYTLVPFGRSEKSPTVAHRGLRKLVVRIDLSLLGRVPSADEITERQSSSSALSLGK
AKEKTSMKHLHHLDQLPGNGRSKRKAENGDAQRENKRNQSRADKLPVSVHNETEETFNKQ
NGYSLPQVDKLGKAVNYVDAALSFMECGKAMEDGPLESKSPYTMYAETVELIRYAMRLKT
HAGPGAIQEDKQLAVLCFRCLALLYWQMFRLKKDNALKYSKVLLDYFKSSPKGSHKPPPW
NDAGKGTVPPASICSVNIMGSHTGSSQSSVISIPHRIHQMAANHLNITNSVLYSYEYWEV
ADNLAKENKEFFNYLNTLTGPLTLHSSMAHIVQYTRQGLQWIRISANLS
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgcctaccattcatggaagtaagggaaaacttgcacgtgtttgtttcatgcttcaccac
gcatcccaggacatgacccactcctggccttaccagcagcccccaggggaagggggcact
cagcatttcctgtactcacacgcaaaggagggaaaacagcccaattcacatcacagacat
gtgagggatggtgtctctatgaggatgccctcacgtccactcgtggcccctcataaatcc
atgctcgctgatgacctgaagcttagcagtgacgaagatgacaaggatgagggaagtgag
cgaacaacttcctgggctgataatgaccgcttgtcaggccagcagcagcaccgccagcag
cagcaccgcacacacacacatgtcggaagagtgagacattctagctcagggtcttcggga
tcagacccttccagtgagtgggaaagcagcagtcagcggtcacacagcccgagcccaggg
acacacaaccggtgcgggacaccgacccaacatcggaccctaaactgcagtacagagacg
gagagcccaccatccacacagtggcagctggacaggtggcttgagaaagtccctaaaaat
catcattcatctgaccacgacccaggtggaggacagcgacggagtgcgaaatctgactgt
ggccgaggaccatcacctggaagatactggagcagagactctgagtccagacgggattac
agtccatgtgaaagtccggtcccaagtccaaaatttgactacagccccagaaacagtcct
catcccagcccagaatacagtccatgccccagtccaggaattagccttgtgccgagccca
gtgccaagtgtatgtccaagtccaggagacagcctccaagggagtcgaagtcccagccct
ttacctttacaccctcccagaagccccagtccaagtctttcatccaccgcagtacctagc
caaggtacatatcctcaggtacagccacctcaaaaagaaagtccaaggcatattgcaagg
ccaaccgttacctctaatccagcacatcatcccaaagtaaggccatgggtacctctggac
catagcgccaaccagagaaaggagtttagacccaaagactctagatccagagactctcga
tccaaagactctagacctggtcctccccaacaaccccatcattccgaacacaactcaaca
gaaaagtcacacaaagatctcacacacaaacctgaagccaaaaactctgaaaccacatgc
aagcaaaggtttaactcaccttcaaaccccatttcaaagcatttgtcaaagcaaagacca
agcgttagcccaaaaccacaagccaggcactcatctacaactgaccatagtattgaacat
aatcacagaagcaatgaacctacaggggtgtcaatccacagttcacactccaaatcaggc
cattcatctcattttaatactctaaagagttccgaacgtggtccctcgtcaaaatccagg
gactcatcccgaagcgaagtcaacagtcgatctagtcacagcttgaagactaaatctttc
ccggatacaaagcagtccatctccaaacagacttcccaacagagttcaagcccaaagccc
aaggtcaaactaggggatgccccagtgccaagaaccgggcattcccaaaaagacccaaag
cccagagagagagagcgagaggtggacaaccgaggtaaggcccagggagcaaccctggtg
cagaccagcaaggagcagagacaaagactggcggaggagcaagtaataaggcgtcgctgg
gttcggagttctgaggaagaggaagacgaggaagataggagaaccgaggaaggggaaaga
gagaggaagcggaggagaaggagggagcaggaagttgaatggaaggcagtgcagcccaag
caaagacctcacaccaacagccagcatcacgctcaaaaggaatacaatggacttaacctt
gaggagcagagaaggaagaagagaaggtggaacaatgaggacatttcctcaggtcctcat
gtgacagacactagcctttctcctccactttctccaccttcccctactcctgtcatcaag
cccactcgtccatcatcttcctcgtcctcatcctcctcatcatcatcgtcgtcctcatca
tcttcctccgagtcagactctgagtccagtccaccccggaatgttgccaaattccctgca
gattcaacatcaaaccaaaaaactgtgtcaaaaaggagcaatgacaaacagacttctggc
actggtgctcacccccacgggtcgagcttaagcacccctgagacagataaacaaggtcgg
ggcagacacaaactctacacactggtgcctttcggccgatctgaaaagtcccccacggtc
gcacatcgaggcctgagaaaacttgttgtgaggatagacctctcacttctgggtagagtc
cctagtgcagatgagattaccgagagacagtcctcatcttcagctttgtcactgggaaag
gcaaaagaaaagacatcaatgaaacacctgcatcacttggaccaactgccgggaaatggc
agaagtaaaagaaaagctgaaaatggagatgctcaaagagagaataagagaaatcaatca
cgtgcagataaactaccagtgtcagtccataatgagactgaggaaaccttcaacaagcaa
aatggatacagtttaccccaggtggataagttaggaaaagctgtgaattatgtggatgct
gctttgtccttcatggagtgtggtaaagccatggaagatggaccgctggagtccaagtcc
ccctacaccatgtatgctgaaactgtggagctcataagatatgctatgagactcaagact
cacgccggacctggagccattcaggaagacaaacagctagctgtactatgtttccgctgt
cttgcacttctttattggcaaatgttccgacttaaaaaggacaacgctctaaaatactcc
aaagtcctgctggactacttcaaaagttctccaaaaggatctcacaaaccccctccttgg
aacgatgctggaaaaggaactgtacctcctgcctccatatgctctgtcaatataatgggg
tctcacacaggcagctcccaaagcagtgtcatcagcattccccatcgtatccatcagatg
gcagcaaatcacctcaacatcaccaacagtgtcctgtacagttatgagtactgggaggtg
gctgataacctggccaaagaaaataaggaatttttcaactatctgaacacactgactgga
cccttgactctgcatagcagcatggcccatatcgtccagtacaccaggcaagggcttcag
tggatccggatcagtgctaatctatcataa

DBGET integrated database retrieval system