KEGG   Cyprinus carpio (common carp): 109097326Help
Entry
109097326         CDS       T05134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 11 homolog
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109097326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109097326
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    109097326
   Hops complex
    109097326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin VPS11_C zf-C3HC4_2 zf-RING_2 zf-rbx1 zf-C3H2C3 zf-C3HC4 zf-ANAPC11 zf-RING_5 zf-RING_UBOX ADIP zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 109097326
NCBI-ProteinID: XP_018966497
Position
19
AA seq 927 aa AA seqDB search
MAAFLQWRRFVFFDKETVKDQSENGKNFQLPVGISACDSGRGHIVLGDMDGQIWFLTRSL
QLSSFQAYKLRVTHLYQLKQHNILVSVGQDEPGINPLVKVWNLDKKDSGSPLCTRIFPAI
PGNKPTEVSCLSVHENLNFMAIGFTDGSVVLTKGDITRDRHSKTLSLHEGNCPITGLAFR
QAGKVTHLFVATLEKVQCYTLSVKEYPRIELDTHGCALRCSALTDPSQDSQFIVAGDECV
YLYQPDERGPCFAFDGHKLLTHWHRGYLLLLTHNNKSPSKSDYGSRQTSPTEKHILTIYD
LDNKFIAYSAAFDDVIDVLAEWGSFYVLTRDKTLYMLQEKDTQTKLEMLFKKNLFVMAIN
LAKSQHLDNDGLSEIFRQYGDHLYVKGDHDGAIQQYIRTIGKLEPSYVIRKFLDAQRIHN
LTAYLQALHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKSNESEVHFDVEIAIKVLRQA
GYHSHAVFLAERHMHHEWYLKIQLEDLKNYQEALRYIGRLPFDQAESNMKRYGKTLMHHV
PESTTILLKRLCTDYHPSKDSTDRDSLDRPAENKANPEEFIPVFANNPRELRAFLEHMIK
VDPFSPEGVYDTLLELRLQDWAHEQDPGKKKALQEAALSLLRSDNTVFDKALVLCQMHNF
KEGVLYLYEKGKLFQQIMHYHMQNEEYGKVVEACKRYGDSEVCLWEQALGYFARKEDNCK
AYISEVLQHIDENNLMPPLLVVQTLAHNSTASLSVIKDYLINKLERETQQIEEDERKIRQ
YREETAHLRAEIQELKTCAKIFQKTKCSMCNSPLELPSVHFLCGHSFHQHCLESFAESEA
ECPTCTPENRKVMDMLRAQDQKRDLHDHFHRQLKCSNDGFSVIADYFGRGVFNKLTLITD
PPGGKSGAGNLEAEFSRDLLINTKRNV
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgttcttacagtggagacgttttgtatttttcgataaagaaacggtgaaagat
cagagcgaaaatgggaaaaatttccaactaccggtcggaatatcggcctgtgattcaggt
cgaggacacattgtgcttggagatatggacgggcagatctggtttttgacccgctccctg
cagctgtccagctttcaggcttataagctgcgcgtgacacacctgtaccagctgaaacaa
cacaacatcctggtgtctgtgggtcaggatgagcctggcatcaatcctctggtgaaggtg
tggaaccttgataagaaggacagcggcagtcctctctgtacccggatattccctgccata
cctggaaacaaacctactgaagtgtcttgtcttagtgtacatgaaaaccttaatttcatg
gcaataggttttacagatggaagtgttgtgctgacgaagggtgacatcaccagagacaga
cacagtaaaactctcagcctccatgagggcaactgtccaatcacaggcctggctttccgg
caggctgggaaagtcacacacctgtttgttgccactttagaaaaagtgcagtgctacacg
ttatcagtgaaagagtaccctcgtatagaactggacacacacggctgtgccctccgctgc
tcggcgcttacagacccctcgcaggactcacagttcatagtggctggagatgaatgtgtg
tatttgtaccagcctgatgagagaggaccctgttttgctttcgatgggcacaaacttcta
actcactggcacagaggatacctgctgctgctcacacacaataacaagtcacccagcaaa
tctgattatggcagcagacagacatcccctacagaaaagcacatcctgaccatttatgac
cttgacaacaagttcatcgcgtacagtgcggcgtttgatgacgtcattgacgttctggca
gaatggggctctttttatgtcctaacaagggacaaaacactgtatatgctgcaagaaaaa
gacacgcagaccaagctagagatgctgtttaagaagaacctgtttgtgatggccattaac
ttggctaaaagtcaacatctggacaatgatggtctgtctgagatattcagacagtatgga
gaccatctttacgtcaaaggggatcatgatggagctattcagcagtatattcgcaccatt
gggaagcttgaaccctcatacgtaatccgtaaatttttggatgcacagaggatacataac
ttgacagcgtacctacaggccctccacaggcagtcactggccaatgctgaccacactact
ctactgctcaactgttacaccaaactgaaggacagctccaagctggaagagttcataaag
agcaatgaaagtgaggtgcatttcgatgttgaaattgccatcaaggtgttacgtcaggct
ggttatcacagtcatgccgtgtttctggcagagagacacatgcaccatgaatggtatcta
aagatccagctagaggatttgaagaattatcaggaggccttacgctacattggaaggttg
ccatttgatcaggcagagagcaatatgaagcgttatggaaaaactttaatgcaccatgtg
cctgaaagcaccacaatcctcttaaaacgcctttgcaccgactatcaccccagcaaagac
tcaaccgaccgggacagcctggacaggcctgcagaaaacaaggccaatccagaagagttc
atcccagtctttgccaataacccacgagagctgcgagcgttcctagaacacatgatcaag
gtggatccgttctcacctgagggagtttatgacactctgctggagctcagactacaggac
tgggcacatgagcaggacccagggaagaagaaagctctgcaggaggcagcattgtccctg
ctgaggagcgacaacactgtgtttgacaaagccctggtgctctgccagatgcacaacttc
aaggaaggcgtgctgtatctgtatgaaaagggcaaactgttccagcagatcatgcattac
cacatgcagaatgaggagtatgggaaagtcgtggaggcctgtaaacgttatggggacagt
gaggtgtgtttgtgggaacaggctcttggctattttgcacgcaaagaagacaactgcaag
gcctacattagtgaagtcctgcagcacattgatgaaaataacttgatgcctccacttctg
gtggtgcagactttggctcataattccacagcatctctgtcagtcataaaagactacctg
ataaataaactggagcgggagacccagcagattgaggaagatgaaaggaaaattcgacag
tatagagaggaaacagcccatcttcgtgctgaaatacaggaacttaaaacctgtgcaaag
atcttccagaagaccaagtgcagcatgtgcaacagcccgctagagctgccatctgtacac
ttcctgtgcggccactctttccatcagcactgcctagagagctttgcagagagtgaggcc
gagtgccccacctgcacccctgagaacaggaaagtgatggacatgttgcgtgcgcaagat
cagaaacgagatctgcatgatcatttccacagacagctcaaatgctccaatgacggcttc
tcagtcatcgctgactattttggccgtggcgtgtttaacaaactcactctgataacggat
cctcctggaggaaagagtggagctgggaatctggaggctgaattcagcagagatctgctc
attaacaccaagaggaatgtttga

DBGET integrated database retrieval system