KEGG   Cyprinus carpio (common carp): 109097335Help
Entry
109097335         CDS       T05134                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03040  Spliceosome
ccar04010  MAPK signaling pathway
ccar04141  Protein processing in endoplasmic reticulum
ccar04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109097335
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109097335
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109097335
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109097335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccar01009]
    109097335
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccar03041]
    109097335
   03009 Ribosome biogenesis [BR:ccar03009]
    109097335
   03110 Chaperones and folding catalysts [BR:ccar03110]
    109097335
   04131 Membrane trafficking [BR:ccar04131]
    109097335
   03051 Proteasome [BR:ccar03051]
    109097335
   03029 Mitochondrial biogenesis [BR:ccar03029]
    109097335
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109097335
Protein phosphatases and associated proteins [BR:ccar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109097335
Spliceosome [BR:ccar03041]
 Complex B
  Other components
   Prp19 complex
    109097335
 Complex C
   Prp19-CDC5 complex
    109097335
Ribosome biogenesis [BR:ccar03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109097335
Chaperones and folding catalysts [BR:ccar03110]
 Heat shock proteins
  HSP70 / DNAK
   109097335
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109097335
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109097335
Proteasome [BR:ccar03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109097335
Mitochondrial biogenesis [BR:ccar03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109097335
Exosome [BR:ccar04147]
 Exosomal proteins
  Proteins found in most exosomes
   109097335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 SHS2_FTSA HORMA
Motif
Other DBs
NCBI-GeneID: 109097335
NCBI-ProteinID: XP_018966509
Position
19
AA seq 240 aa AA seqDB search
MTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPR
GVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKVED
DVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEK
EEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPEGMPGGFPGAGSAPGGGSSGPTIEEVD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcctcatcaagcgtaataccactatcccaaccaaacagactcagactttcacc
acctattctgacaaccagccaggtgtgctcattcaggtttatgagggtgagcgtgccatg
accaaggataacaacttgctgggcaagtttgagcttactggaatcccccctgcacctcgt
ggtgttccccagatagaggtcacctttgacattgatgccaatggcatcatgaatgtttcc
gctgttgataagagcactggcaaggagaacaaaatcaccatcaccaacgataagggtcgt
cttagcaaggaggacattgagcgcatggtgcaggaggcagagaagtacaaggttgaggat
gatgtgcagcgtgacaaggtgtctgccaagaatggtctggaatcctatgccttcaacatg
aaatccactgttgaggatgagaaactaaagggcaagatcagtgatgaggacaagcagaag
atccttgacaagtgcaatgaagtcatcagttggcttgacaagaaccagactgctgagaag
gaagaatttgagcaccagcagaaggagctggagaaggtatgcaaccccatcatcaccaag
ctgtaccagagtgctggaggcatgccaggtggaatgcctgaaggtatgcccggcggcttc
ccaggagccggttctgctccaggaggtggatcctccggcccaaccattgaggaggtcgac
taa

DBGET integrated database retrieval system