KEGG   Cyprinus carpio (common carp): 109097684Help
Entry
109097684         CDS       T05134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109097684
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    109097684
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109097684
NCBI-ProteinID: XP_018966839
Position
20
AA seq 238 aa AA seqDB search
MSPFLALGTHFGKVYLLDIQGNVTQKFEISPVKINQISLDESGDHVGICSEDGKVQVFGL
YTREGFHENFDCPIKVVALHPQFSKSNNKQFVTGGNKLLLYERNWLNRWKTSVLHEGEGN
ITNVKWRANLIAWANNVGVKIYDISSKQRITNVLRDNTNLRPDMYPCSLCWKDNTTLIIG
WGSSVKICVVKERDPTEMRDLPSRYVEIVSAFETEFFISGLAPLADQLVTLYYVKGQL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctttcctggctcttgggactcactttggaaaggtttaccttttggatattcaa
ggaaatgttacacagaagtttgaaattagtccagtgaaaataaaccagatcagtttggat
gagagtggcgatcatgttggcatctgctctgaagatggaaaggtgcaagtgttcggcctg
tacactagggagggcttccatgaaaactttgactgtcccatcaaggtcgtagcgctacac
cctcagttcagcaaatccaacaataaacagtttgtgactggaggaaataagcttttgctt
tatgagagaaactggctgaaccggtggaagacctctgttctacatgaaggagagggaaac
atcaccaatgtgaaatggagagccaatctcattgcctgggcaaacaatgtgggtgtgaaa
atttatgacatcagcagtaaacagcgcatcactaacgtgttgcgggacaacaccaatctt
aggccggatatgtacccctgcagtctgtgctggaaagacaacaccacgctgatcatcggc
tggggctcttctgttaagatatgtgtcgttaaagagcgtgacccgacagaaatgagagat
ctacccagtcgctacgttgagattgtgtcagcattcgagaccgagttcttcattagtgga
ctggcgcctttggcagatcagctagtcactctgtactatgtcaaaggacagctctga

DBGET integrated database retrieval system