KEGG   Cyprinus carpio (common carp): 109097984
Entry
109097984         CDS       T05134                                 

Definition
(RefSeq) delta(14)-sterol reductase-like isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00100  Steroid biosynthesis
ccar01100  Metabolic pathways
Module
ccar_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109097984
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109097984
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 109097984
NCBI-ProteinID: XP_018967157
Position
20
AA seq 393 aa
MKPNKHKLTHSAEREFGGALGATCIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPTAHL
WDPLAAVLVVGWITLQSFLYLLPIGKVSEGLVLRDGSRLKYPINGFHALSITAVLLIVCL
WLGMPHGYLFELILPLAVCAIGVSYLLSMYLYIRSFWAPQHALSLGGNTGNPLYDFFMGR
ELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMLLVNGFQLLYVTDA
LWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYGLQAMFLVVHPQSLSTLGAAGIILLN
GIGYYIFRKSNSQKNQFRRDPTHKKCSTPGNYCHSNRKASVGIRVVGVCQASKLPGGPSH
GSGVVPALWNVAYSALLLCHLFHHSAHSPRGQR
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaagcctaacaagcacaaattaacacattcagctgaaagggaatttggaggtgctctt
ggtgccacctgcatccctgtgttcctgcctctgacggttctgtacctgctgagtgtgtgt
cggtctccagcagccagtgtcctgcagtggccccctccattaccccccactgcacattta
tgggaccctttggccgcggttctggttgtaggttggatcaccctgcagagttttctctat
ctactgcccatagggaaggtttctgaaggattggtcctcagagatggatccagactgaaa
tatcctattaatggtttccatgccctgagcattactgctgtcctgttgatagtatgtctt
tggctgggaatgccacacgggtatctatttgagctgattttgcctcttgctgtttgtgcc
attggtgtgtcctacctgctgtctatgtacctgtatatccgctctttctgggcacctcaa
catgctttatcacttggaggaaacacaggaaatcctctgtatgacttcttcatgggtcga
gagctcaaccctcgcattggagactttgacttgaaatatttctgtgaactaagacctgga
ttaataggctgggtggtaataaacctggggatgttaatgaaagaagtggagttgagaggc
tctccatctcttgccatgctgcttgtcaacggcttccagctcctctatgtgacagatgct
ctgtggaatgaagaggctgttcttactactatggacattgtgcatgatggatttgggttc
atgttggcgtttggtgacctggcctgggttcccttcacgtatggtcttcaggccatgttt
ctggttgtgcacccacagtcacttagtactcttggagcagcggggattattcttctaaat
ggaattggttattacattttccggaagtccaactctcagaaaaatcagttcagaagagac
cccacacataaaaagtgtagcacacctggaaactattgccacagcaacaggaaagcgtct
gttggtatcagggtggtgggggtttgtcaggcatccaaactacctgggggaccttctcat
ggctctggcgtggtccctgccttgtggaatgtcgcatattctgccttacttctatgtcat
ttatttcaccattctgctcattcaccgagaggccagagatga

DBGET integrated database retrieval system