KEGG   Cyprinus carpio (common carp): 109099438Help
Entry
109099438         CDS       T05134                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109099438
Membrane trafficking [BR:ccar04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109099438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 HetR_C
Motif
Other DBs
NCBI-GeneID: 109099438
NCBI-ProteinID: XP_018968492
Position
23
AA seq 201 aa AA seqDB search
MFGTYFRVGFYGSKFGDLDEQEFIYKEPGITHLPEISHRLENFYSQCFGDEVLEMIKDST
PVDRKKLNPNKVYIQITFVEPFFDDYEMKDRLTNFEKNFNLRRFMYTTPFTKSGRPRGEL
NEQYKRKTILTTMHAFPYIKTRINVIQKEEFDLTPIEVAIEDMQKKTRELAEATHREKPD
AVMLQMVLQGSVTATVNQVGN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaacatacttccgcgtgggattttatggctctaaatttggagacctggatgag
caagaatttatctacaaagagccaggaattacccatttaccggagatatcccaccggctc
gagaacttttacagtcagtgttttggagatgaagttttggaaatgattaaagattccaca
ccagtagacaggaagaagctgaatcccaacaaggtgtacatacagattacctttgtggag
cctttctttgatgactatgaaatgaaagaccgcctcaccaattttgagaagaacttcaac
cttcgtcgcttcatgtacactacgccgttcacaaagagtgggcggccccgaggcgaactc
aatgagcaatacaagcggaaaactatcctaaccaccatgcatgccttcccctacatcaag
acacggatcaacgtcattcagaaggaggagtttgacctcactcccatcgaggtggccatt
gaggacatgcagaagaagactagagagctggctgaagccacgcacagagagaagccggat
gctgtgatgcttcagatggttctgcagggatctgtcacagccaccgtcaatcaggtcgga
aattaa

DBGET integrated database retrieval system