KEGG   Cyprinus carpio (common carp): 109099593
Entry
109099593         CDS       T05134                                 

Definition
(RefSeq) endothelial PAS domain-containing protein 1-like
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109099593
   04131 Membrane trafficking [BR:ccar04131]
    109099593
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109099593
Membrane trafficking [BR:ccar04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    109099593
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD PAS HIF-1 PAS_9 PAS_4 HLH
Other DBs
NCBI-GeneID: 109099593
NCBI-ProteinID: XP_018968647
Position
23
AA seq 845 aa
MTAEREKKRHPSERRKEKSRDAARCRRSKETEVFYELAHQLPLPHSISSHLDKASIMRLA
ISFLRTRKLFNSGCTVQQTWSQDDSQMDSLYLKSLEGFVAVVTSDGDMIFLSENVSKFMG
LTQVELIGHSIFDFTHPCDHDEIRENLNVKSGDTKFGKRERYEHGQRFFMRMKCTVTNRG
RNVNLKSASWKVLHCTGHLQVCSSRPPQVLYGFSEPPLTCVTMLCAPIPHPSNVDTPLDS
KTFMSRHSMDMKFIYCDERVSSLIGYRPEELLGRSVYEFCHALDSESMTKSHQNLCNKGQ
VVSGQYRMLAKHGGYVWVETQATVIYNNRNSQPQCIICINYVLSSVEEQSVIFSLDQTES
LFKPYHMCSMGELFSQGRASSVSEAEDILFTKLKEEPEELAQLAPMPGDAIIALDFDRPD
FEEQTFFSKSTKLPVVGPSWVVDTPPDGSLDRKLSNMPSTFTRPQVPPAGKCTPCSTPCL
SGRSSCSTPSSPEDYCGSGECDLKVQVTEKLFASDSVATNPTGSQLDLSDLDLETLAPYI
PMDGEDFQLHPICLEEPVPDTGPGLSTALQHSFSSVADLFQPLSPFPPDNKSGTNTCPDM
AHVQPYQTAPNIPHSSKEGRQSLQWPRDPPSQYEHADIGCMDDQSIAYPGQTCDFNSALP
QQRFYESFAPVQKGRNVGQIALVNSFKRKRQSEFSTSCSFTDILKQVVAPHKSADGMQKR
MKTMNVDSCAFSVRKSLSTSVLTDKFPHMQSGLVSPHGCSQSLKGSSEDPKQHFPESFFS
PSNRQYNMMPLHKHTGIINQLLGPSFDSYCLPELTRYDCEVNVPLQGNLHLLQGSDLLRA
LDQTT
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgacggccgagagagagaaaaaaaggcatccttcagaaaggcgcaaggaaaagtcccgt
gatgcagcgcgctgcaggcgcagtaaagagacagaagtgttctatgagctggcccatcag
ctgccgttaccccacagcatcagctcccacctggacaaagcctccatcatgagactagct
atcagcttcctgcgcacacgcaaacttttcaactcaggctgcacagtccaacaaacctgg
tcacaggatgacagccagatggacagtctatatctaaagtctctggaaggctttgtcgct
gtggtaacatcagatggagacatgatattcctttcagaaaatgtcagtaaatttatgggc
cttacgcaggtagaactgataggccacagcatctttgacttcacgcacccctgcgatcat
gatgaaatccgagagaatctcaatgtcaaatcaggtgacaccaaatttggcaagagggaa
agatatgagcatgggcagagattttttatgaggatgaaatgtacagtcaccaatagaggt
cgcaatgtcaacctcaaatcagccagctggaaggtgctgcattgcacggggcatctccaa
gtgtgcagcagccgcccccctcaagtcctctatgggttttcggagccacccctcacatgt
gtcactatgctgtgtgcgccgatcccacacccctcaaatgttgacacacctcttgacagc
aagacgttcatgagcagacacagtatggacatgaagtttatctactgtgatgagagagta
agcagcctgatcgggtataggccagaggaacttcttggccgttcagtgtatgagttctgc
catgctttggattctgaaagcatgacgaagagccaccaaaatctttgtaataagggtcaa
gtggtgagtggccagtacagaatgctagccaagcacgggggctacgtgtgggttgagacc
caggcaaccgtcatctacaacaatcgcaactcccaaccacagtgcatcatctgcatcaac
tatgtcctgagttctgttgaggagcagtctgtcatcttctccctggatcagacggagtct
ctgttcaagccctaccacatgtgtagcatgggagaactgttcagccagggtagagcttcc
tctgtttcagaagctgaagacattcttttcactaagctcaaggaggagcctgaggagtta
gctcagttagcgcccatgccaggagatgccatcattgccctggactttgataggccagat
tttgaagaacagactttcttctccaagtccaccaagcttcctgtggtgggaccgtcatgg
gttgtggacacaccccctgatggcagtcttgatagaaaactgtccaacatgccctccacc
tttaccagaccccaggtgcctcctgcaggaaaatgcacgccctgttccacaccctgctta
agtggccgcagcagttgttctacacctagcagtccagaagattactgtgggagtggagag
tgtgatctgaaggtgcaggtgacagagaagctatttgcctctgactctgtagccacaaat
cccactggctcccagttggacctgagcgatctggacctggagactcttgctccatacatc
ccaatggatggtgaggacttccagctgcaccccatctgcctggaggagccagtgcctgac
acaggtccaggcctgagcacagccctccagcacagcttcagcagcgtggctgacctcttc
cagcccctgagtcctttccctcctgacaacaaaagcggcactaacacatgtccggacatg
gcacatgtgcagccttaccaaaccgcaccaaacatcccacattcctctaaggagggtaga
cagagtcttcagtggccccgtgacccaccctcacagtatgaacatgcagatatcggatgc
atggatgaccaaagcatagcatatccaggacaaacatgcgatttcaactctgcactacca
cagcaaagattttatgagagctttgcccctgtacagaaaggcaggaatgtgggtcagata
gctctcgtcaacagctttaaacggaagaggcaatcagagttcagtacatcatgctctttc
actgatattttaaagcaggtggtagctcctcacaagtctgcagatggaatgcagaaaagg
atgaagacgatgaacgtcgacagctgcgctttctctgtcagaaagtctctcagcacaagt
gtgctaacagataaatttccacatatgcaaagtggattggtttctcctcacggctgcagt
cagtctctcaaagggagctcagaggatcccaaacagcatttcccagagtcattcttctct
cccagtaacagacaatacaacatgatgcctctacacaaacacacaggcataataaatcaa
ctgttaggcccatcatttgactcatactgtctgccagagctgacacgatatgactgtgag
gtaaacgtgcctctacagggaaacctgcatctgcttcagggcagtgacctcttgagagct
ttggaccagaccacgtag

DBGET integrated database retrieval system