KEGG   Cyprinus carpio (common carp): 109099721Help
Entry
109099721         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109099721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109099721
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109099721
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: STE group
  STE20 family
   109099721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Kdo RIO1 FTA2 APH Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 109099721
NCBI-ProteinID: XP_018968791
Position
23
AA seq 255 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPQILRPDSSP
RNGRRSSSASSRAVW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccggcgaagagcctggtggacatcgacctcgcctctctgcgggac
cctgctggtatttttgagctggtggaagtggtcggcaatggcacctacggacaagtgtac
aagggtcgacatgtcaaaactgggcagctggcggccatcaaagtcatggacgtgactgaa
gatgaagaagaggagattaagctggagattaacatgctgaagaaatactctcatcacaga
aacatcgccacgtattacggcgccttcatcaagaagagtcctccaggacacgacgaccag
ctgtggctggtgatggagttttgtggagccgggtcgatcacagatcttgtgaagaacact
aaagggaataccctgaaggaagactggatcgcatacatctccagagaaatcctcaggggt
ctggctcacctgcacgctcatcacgtcatccacagagacatcaagggccagaacgtgctt
ctgacggagaacgccgaggtcaagctagtggacttcggcgtgagcgctcagctggatcga
accgtgggccgcaggaacaccttcatcgggacgccgtactggatggctcccgaggtcatc
gcctgcgacgagaacccggacgccacgtacgactaccggagcgacctgtggtcctgcggg
atcactgccatagagatggccgagggcgctccccaaatcctccgcccagactcaagtcca
agaaatggtcgaagaagttcttcagcttcatcgagggctgtctggtga

DBGET integrated database retrieval system