KEGG   Cyprinus carpio (common carp): 109099926Help
Entry
109099926         CDS       T05134                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1A-like
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04060  Cytokine-cytokine receptor interaction
ccar04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109099926
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109099926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109099926
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccar04090]
    109099926
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109099926
Protein kinases [BR:ccar01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   109099926
CD molecules [BR:ccar04090]
 Proteins
  109099926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp TGF_beta_GS Pkinase_fungal FTA2 Haspin_kinase DUF4381 APH
Motif
Other DBs
NCBI-GeneID: 109099926
NCBI-ProteinID: XP_018968945
Position
24
AA seq 604 aa AA seqDB search
MGAGSNFFSLVKSTRAFKTKGNYPRSLQRFLLNDEGDWSASENKTGDSVPLPSFPMLHRS
TTLGHPPRSYYRKRVESIVDAVNFPDTLTISCIVLADSVGFFFFCTGVKSGSDPKRPQSG
DGSTVAPEDAARFLSCYCSGHCPEDATNNTCDTNGQCFAIIEEDEHGEAILTSGCMKYEG
SHFQCKDSPNAQTRRTIECCSTDFCNRDLQPTLPPPIPGKPPLWNTHLLAFLISVTVCCF
TLVAITVVCYYRYKLQTGRRRYQRDLEHHEAFIPAGESLKDLISQSSTGSGSGLPLLVQR
TIAKQIQMVRQIGKGRYGEVWLGRWRGEKVAVKVFFTREEASWFRETEIYQTVLMRHENI
LGFIAADIKGTGAFTQLFLITDYHENGSLYDYLKYTTLDTQALLRLAYSAACGLCHLHTE
IYGTQGKPAIAHRDLKSKNILIKKNGTCCIADLGLAVKYNSDTNEVDVPLSTRMGTRRYM
APEVLDETLNKNQFQAYIMADIYSYGLIVWEMARRCVTGGIVEEYQLPYWDMVPSEPSYE
DMREVVCVKGMRPVVSNRWNSDECLRAMLKLMSECWAHNPASRLTALRVKKTLAKMVESQ
DIKI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggcagcaatttcttctcactcgtaaagtcaaccagagcctttaaaacaaag
ggtaactaccctcggtcattgcagaggttcctgttaaatgatgagggagactggagtgcc
agtgagaacaagacaggtgattctgttcctctgccctcatttcccatgctgcaccgctct
accacgctgggccacccgcccaggtcctactacaggaaacgtgttgagtctattgtcgat
gctgtgaatttccctgacactttaaccatttcctgtattgtgctggctgacagtgttggg
ttcttttttttttgcactggggtcaagtccggatcagatccaaagagaccccagtcaggg
gatgggtccaccgtggccccagaggatgctgcccgcttccttagctgctactgttcaggc
cactgccccgaagatgccacaaacaacacctgcgacacgaacggacagtgttttgcaatc
atagaggaggatgagcacggcgaggctatcctcacctccggctgcatgaagtatgagggc
tcccacttccagtgcaaggactctcctaatgctcagaccagacggaccattgagtgctgt
tccactgatttctgtaatagagaccttcagcccacacttccacctcctattccaggaaag
cctccgttatggaacacccacttgctggcctttctgatctctgtgacggtgtgttgcttc
actttggtggccataactgtggtgtgttactacaggtataagctgcagacaggacggaga
cggtaccagagagatctggaacatcacgaggccttcatccctgcaggagagtctctcaaa
gatctcattagtcagtccagcactggctccggttcagggctccccctgctggtccagcgc
accattgccaaacaaattcagatggtacgtcaaatcgggaaggggcggtatggagaagtg
tggcttggtcgctggagaggagaaaaggttgcggtgaaagtgttctttacccgtgaagag
gctagttggttcagagagaccgagatttaccaaacggtgctcatgaggcacgaaaatata
cttggctttatagctgcagatattaagggcacgggagcgttcactcagcttttcctcatc
acagactaccatgagaatggttctctctatgactatctgaaatacaccaccctggacaca
caggctctgttgaggctggcctattccgcagcctgcggcctgtgccacctccacacagag
atctatggtacgcagggcaaacctgccatcgctcacagagacctgaagagcaaaaacatc
ctcataaagaagaatggtacctgttgcattgctgatctgggcctggctgtgaaatacaac
agtgataccaatgaggtggacgtccctctgagcacaaggatgggtacacggcggtacatg
gcaccagaggtcctggatgagaccctaaataagaaccaattccaagcgtacataatggct
gatatttacagctatgggctcattgtttgggagatggcccgccgatgcgtgacaggaggt
attgttgaggagtatcagctgccatactgggacatggtaccttcagaaccgtcttacgag
gacatgagggaagtggtgtgtgttaaaggcatgcgaccagtggtgtctaatcgctggaac
agtgacgagtgcttacgggccatgctaaagctcatgtctgagtgctgggcacacaaccca
gcctctcgtctcacagctcttcgagtcaaaaaaacacttgccaaaatggttgaatcacag
gatatcaaaatatga

DBGET integrated database retrieval system