KEGG   Cyprinus carpio (common carp): 109100777Help
Entry
109100777         CDS       T05134                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109100777
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109100777
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ccar04812]
    109100777
   04147 Exosome [BR:ccar04147]
    109100777
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109100777
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109100777
Membrane trafficking [BR:ccar04131]
 Others
  Actin-binding proteins
   Others
    109100777
Cytoskeleton proteins [BR:ccar04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     109100777
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109100777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Pur_ac_phosph_N Ig_2 fn3_2 C2-set_2 Receptor_2B4 V-set SusE DUF11 Herpes_gE VID27_N
Motif
Other DBs
NCBI-GeneID: 109100777
NCBI-ProteinID: XP_018969756
Position
3
AA seq 4372 aa AA seqDB search
MVPYQSVLDSPSAPLNFEIKDVKRDSVQLQWEPPQIDGGAKITHYIVEKRESKRLAFTTV
TNSCVRNSFKVDDLQEGGLYHFRVLAVNELGVGLPAETIEAVKVSQAPLPPGKIKVVDVT
RHTVTLAWEKPDHDGGSKITGYTVEMNTKGSDKWTVCATVKALETTIEGLTTGEEYSFRI
TAINDKGKSDPKPLGASVVARDITIEPIIDLLFNTYSVKAGDDLKIDVPFRGRPPPEVTW
KKDSHSLKQTTRVNVLTSKTSSKIVIKDATREDAGKYEIILTNSIGIKSAEISVIVLDKP
GPPGAIKVEEISADFISLSWDPPIYDGGCQINNYVVEKRDMTTTAWQIVSATVARTSIKV
TRLTQGTEYQFRVAAENRYGKSHAVDSSPVVAQYPFSPPGPPTSLRIAQATKSGMLVTWN
RPASDGGSPIFGYHLECKDQSSILWTKMNRGPITETQFKVTGLEEGLLYQYRVYAENIAG
IGPCTKACDPVSARDPCAPPGQPVVMNITRTSVSLSWAIPEFDGGAKVTGYIVERRELPD
GRWLKCNFTNLQETFFDVTGLIEDQRYDFHIIAKNAAGLLSEPSEGTGPVTVKDDVDPPR
ITIEDKLRQLVIVKAGDMLRIDAEISGRPIPVISWAKDGKEIEAKARFEISSTLTSTTLI
VRDAIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPSAGPLEVTGLTAEKCTLTWGPPQ
ENGGAEIQHYIVEKRETSRLAWTLVYADMKATTCKVTKLLKGNEYIFRVRGVNKYGTGEA
LESDPVKAMDPFTIPAAPTNVEVTSVTSEAMTVCWERPVSDGGSSIAGYVIEKREKSGLR
WVRVNKKPVYDLRVKASNLREGCEYEYRVFAENAAGLSAPSVPCPLTKAEDPLFLPSPPA
KPKIIDSSKTSITLSWNKPLFDGGSPVTGYMVEYRNTTDDDWTLGVSNTKSTEFTVVGLT
SGAEYVFVVRSINKIGPSEPSPETDPQIAKDREDEPIFLISNEMRKTLIVKDGSSFTLRV
PFKGKPVPHVMWNKPDVDLRVRAAIDTTDNCTSVTIEQATRDDSGKYTVTLQNVAGTSTL
TLSVKVLDSPGPPAHIEIKEVTKTSATITWDTPENEGGAPVKNYLVDLREATKMGWTRIT
DSCPRLTYKVNDLQEGGVYYFRVTGENEYGIGVPLETKEGTKITEKPSPPPKLGVTDVTK
DSVSLSWLKPEHDGGSRITNYLVEALEKGQQKWIKCGSTKSTHFVVYGLRENAEYYFRVR
AENHAGLSDPKDMVLPVLVKDQLEAPEINMKDFQHNTAFVKAGSNLKIEIPLTGKPQPKV
SLSKDGQVLKSTMRFNSDVTTDSLIIYLRESVASDAGRYDITASNSSGTTKSFVNIVVLD
RPSPPVGPVEMCDVTEDSVSLKWLPPAYDGGSPITNYIVFKRETITANWVEVSSAVARCT
IKIMKLINGVEYQFRIRAENRFGISDHIDSPTVTVSLPYTLPVAPSQPWVSAVTKESITV
NWKEPSSDGGSHVFGYHLQMKDRNSILWQKVNTTVIRATHFKVSNVNAGLIYEFKVAAEN
AAGIGPVSKSSDPVLAIDACESPNNLRVTDITKSSISLSWEKPSYDGGSKITGYLIERKD
GPKGRWSKANLTNVTDTKFTVSGLTQNESYEFRVMAKNAVGSISNPSATVGPVTCVDTYG
APEIEFPPEYLDVVKYKAGATVHLKIGIIAKPQPTIEWYKDGKELESGAQISISNTTESA
CISIREASRLNSGTYELKIKNSLGSAYAAVRVLVQDKPGPPAGEIQFKKITADTMTIMWD
PPDDEGGAMVTHYIVEKRETSRILWSIISEKLEDCIVTVPRLIKGNEYIFRVRGVNKYGV
GDPLESRPVIAQNSFVPPSRPSKPQVTMITRSTMTVVWERPSLDGGSDIDGYYLEKREMK
SLQWFKVIKDAIRDTRQKVSNLTEGNDYQYRVCAINKAGAGPYSDVSIFYKAYDPIDPPS
EPTKLRVVDSTKTSITLGWVKPVYDGGSEITSYVVEQRLADETEWVTISSKGEIRTTEFV
VSHLKPGVYYFFRVSAVNCAGTGRSIEMMQPVQAKDILEEADVDLDISMSTQYIAKAGRD
VEIVIPLKGRPAPNVTWRKGDKNISGDARYAIRNTEYSTTLIIPKVTRDDTGKYLLEIEN
GVGEPKTITVSVKVLDTPSACNRLIVKNVTRGKLTLSWEPPYIDGGSPITNYVVEKKDAK
MKAFTIVTNECANTTYKVDGLSEEISYFFRVSAENEYGVGDPCETAQPVRATEMPGAVKD
LVLVDSTNTSVSLAWTKPDHDGGSHISEYIIEKKTKEEEAWSIGGTCRRCQYEVTHLKEL
SEVYFRVLAKNEKGCSDFSQIGPITVKELLIPPEANLIDYPNSELSVRIGQNVNIDLPYK
GKPKPTIQWMKDDVPLKESEQVRFRQTENKASLIVRNARKENAGKYTLVLDSKLVKNFFD
IKVITLGPPSQPIGPIRFDEIKAQSIIISWDEPQDNGGGEITCYSVEKRETSQAAWKMVC
SSVVRTTFKIPNLVKGTEYQFRVRAENKYGMSEPLTSLDVVAQHQYKPPGSPGKPVVFNV
TSDGMTVQWEAPGFDGGSPITGYHLEKKDRNSLLWMKVNSSVISGREYRVIGLIEGLEYS
FRVYAQNNAGMSPVSEQSKHKLAISPVDPPGTPNCIDVTRDSVTLQWEPPKRDGGSRIVA
YSVERRQGRARWLRCNFIDISECQFTVTGLPAGDRFEFRVIARNAVGTVSPPSQSSGYIM
TKDECVIPEIQFEAEKTLTIKAGENIKLNCSISGRPVPQVTWYKDGKEVDKMLVDITTVI
GSSSLFIRDADRNDRGIYTVEAKNSSGTTKVDVLVRVQDTPGPPEGPLRFTNISAEKATL
WWSPPENDGCAPIINYVIEKRETSRISWALVTSKCEACSFNATKLIKGNEYQFRVSAVNK
FGVGKPLESDPIIAQMQYTVPDAPGTPDCTHVTGNSITLCWTRPRHDGGNEIKQYILERR
EKKSLRWVKVSAKRPVTELRHRVTNLTEGNEYEFRVMAENGAGIGPASGTSRLFKCREPT
SAPSAPTVVKVIDSTKMSVTLEWTKPVFDGGMEIIGYIIEMCKASLEEWHRVNNQTCIHT
HYTVTELEPGEEYKFRVCAVNGAGKGEFSETPNVVQAVDRLTSPEIDIDANFKQTHVVKS
GGTVTLHIPFRGKPAPLATWTKADGDLGVMVDINTTETFSTLTIENCTRYDAGKYTLSLE
NNSGRKAITLTVKVLDTPGPPGPLSFKDVTRGALTLMWDAPSNDGGARVHHYIVEKREAS
RLSWQEVSEKCTRQILRVANLDIGVAYFFRVIAENQYGKGEPFEMTEPIIATEEPAPPKR
LDVIDTTSSTASLVWMKPEHDGGSRITGYIVETRKKGSDHWVVGGQTKSLKMVLEGLVEN
TEYEFRVKAQNDAGISQPRDALASVIIKEPRIEPTADLSGIDKQLITCKTGNSFAIDIPI
SGRPAPKVTWKLEEMKLKETDRVSVKISKDRTTLLVKDAKRGDSGKYYLTLENVAGSKTF
TVIVSVIGRPLPPTGPVEISGISSESCVLTWGEPADDGGTDITNYIVEKRESGSTTWQVV
NSSVKRTTIKVTHLTKYMEYTFRVCAENKFGVSKSIESQAIVAEHPFISPSPPTRPDVVS
VSANAISIRWDVPYHDGGSQVTGYWIEKKERNTILWVRENKIPCLECHYKVSNLIEGLEY
QFRVYAMNIAGLSKASEPSRPVLALNPVDPPGKPEVYDVTKTSVSIRWSIPFNDGGSKIV
GYVVERKALGDDEEARWLKCNYTTITENVFTVTSLSEGEQYEFRVIARNGAGVHSMPSES
TGLITCKDEYTPPKAELDSKLVGETITIRAGSDLVLDAAVGGKPEPKVFWAKGDKELELG
EKYSLTYTSTRAMAIIKTCDRNDTGRYILTVKNASGIKTAAVNVKVLDTPGPPEGTITIS
RVTEEKCTVSWKIPMEDGGDRVTHYIVERRETSRLNWVIMEAECKTLSCVSTKLIKNNEY
IFRVRGVNKYGPGVPLESEPVIARNAYTVPTPPEAPVITAVGKEHVIIEWLKPESDGGSE
IKNYLVDKRETSSVRWTRVNKTYTIYDTRLKITGLLEGSDYQFRVSAVNAAGTSVPSDAS
QYAHCRDPTYTPAPPSVPRVTDTTKHSISITWSRPMYDGGSDVTGYVVEILEEGTEQWYR
ATQKILTSTQYTVAGLASNKKYSFRVAAVNAMGTGEFSEGSIEAAPSERVEIPDIELPDE
LKKTVCIRAGNTLRLHVTTAGRPAPVVTWRKPGIDLQSRGFIDTTENTTTLIVEKVHRYD
AGKYTIEAENPSGKKIVTILVKVYDTPGPCGAVNVKDYTKRVCCNHMGCAYC
NT seq 13119 nt NT seq  +upstreamnt  +downstreamnt
atggtaccttaccagagcgtacttgactctccaagtgctccattgaactttgaaattaag
gatgtaaagagagattctgtccagctacagtgggagcctccacaaattgatggtggagcc
aagatcacccattacattgtggaaaagcgtgaatctaaaaggctggcatttacaactgtg
acaaacagctgtgtcagaaattcattcaaggttgatgatctccaggaaggaggtctttac
cacttccgtgtattggctgtgaatgaacttggtgttggtttgcctgcagagaccatagag
gctgtcaaagtttcccaagcacccttaccacctggtaaaattaaagttgttgatgtaact
cgccacactgttactctagcatgggaaaagccagatcatgatggtggcagcaaaatcaca
ggctacacagtggaaatgaatactaagggatcagataaatggactgtatgtgctacagta
aaggcactggaaaccacaattgaaggacttacaacaggagaggaatacagcttcagaatt
acagcaattaatgacaaaggaaagagtgatcctaaacccctgggagcatctgttgtggca
cgagatattactattgaacccattattgatttgctgtttaatacctacagtgtaaaggct
ggagatgatctcaaaatagatgttcctttcagaggcagacctcctccagaggttacatgg
aaaaaggatagtcactcattgaagcaaacaaccagagttaatgttttgacatcaaaaaca
tcatcaaagattgtcatcaaggatgcaacaagagaggatgctggaaaatatgaaattatt
ttaaccaattcgattggcattaaatcagcagaaatatctgttattgttcttgataaacca
ggtccaccaggtgcaatcaaggttgaggaaataagtgctgattttatttcactatcatgg
gaccctccaatttatgatggtgggtgtcaaattaataattatgtggtcgagaagagagat
atgaccactacagcatggcaaattgtttcagcaacagttgcaagaacatcaatcaaagta
actcgtttgacacaaggaacagaatatcagttccgtgttgctgctgagaatcgttatgga
aaaagccatgcagttgactcgtccccagttgttgcacagtaccccttctcacctccaggc
cctccaaccagtcttcgcattgctcaagccactaaatcaggaatgctagttacctggaac
agaccagcaagtgatggtggcagtcccatctttggatatcacttggaatgcaaagatcag
agcagcattctctggacaaagatgaacagaggacctattacagaaactcagttcaaggta
actggtttggaagaaggcctgttgtatcagtacagagtatatgctgagaatatagctggc
attggaccttgcacaaaggcatgtgatcctgtttctgcccgagatccatgtgcacctcca
ggtcagccagtagttatgaacatcacaagaacatctgtttctctctcctgggcaatacct
gagtttgatggtggagctaaggtgactggctacattgttgaacgcagggaacttccagat
ggacgatggttaaagtgtaatttcaccaatcttcaagaaacattctttgatgtgactggc
ctgattgaagatcaacgatatgatttccatataattgctaagaatgcagctggcttactc
agtgaaccatcagagggtacaggacctgtgactgtaaaagatgatgttgatccaccacga
atcacaattgaggacaagctaagacaactggttatagtgaaagctggagacatgctgaga
attgatgctgaaatatcaggacgtccaattcctgtgatttcatgggcaaaggatggaaaa
gaaattgaagccaaggccagatttgagatttcttcaacactcactagtacaacactaatt
gtgagagatgccattagacgagactctggacagtatgttctaacattgcaaaatgttgca
ggcaccagatctttagcagtaaactgtaaggtcctggacaggcctggcccatcagctgga
ccgttggaagtaactggtctgactgcagagaaatgtacattgacctgggggccacctcaa
gaaaatgggggtgctgaaattcagcactacatagttgagaaacgtgaaacaagccggctt
gcctggactctggtctatgcagatatgaaagccacaacatgtaaagtaacaaaactgctc
aaaggcaatgagtatatatttagagttcggggagttaataagtatggaaccggtgaagct
ctggagagtgatcctgttaaagcaatggatccatttacaatccctgctgcaccaacaaat
gttgaagtcaccagtgttacaagtgaagcaatgacagtttgctgggaaagacctgtctct
gatggaggcagtagtattgctggctatgtaattgagaaacgtgagaaatctggtcttcgc
tgggtacgtgtcaacaaaaagcctgtgtatgacttaagagtgaaagcttccaatctccgt
gaaggatgtgagtatgaatacagagtatttgcagagaatgctgctggtttgagtgcacca
agtgtgccttgcccactgacaaaggcagaggatccattgttcctaccatcacctccagct
aaaccgaaaataattgattcttctaaaacatcaataactttgtcttggaacaagccatta
tttgatggtggctctccagttacaggatatatggtggaatataggaataccactgatgat
gactggacacttggtgtcagtaacactaagagcacagagttcactgtggtgggactcact
tcaggagcagagtatgtctttgtagtcagatcaattaacaagattggtccaagtgagcca
agccccgaaactgatccacagatagcaaaggacagagaagatgagccaattttcctaatc
agtaatgaaatgaggaagacactgattgtcaaagatggcagctcatttacacttagagtc
ccattcaagggaaagcctgttccacatgtaatgtggaacaaaccagatgttgatctgaga
gtgagggctgctattgacacaactgataactgcacatctgtcacaattgagcaagctaca
agagatgactcagggaagtacactgtaaccctccaaaatgttgctggaacttctacactg
acattgagtgtaaaggtcctagattctccaggcccaccagcccacatagaaataaaggaa
gtcaccaagacctctgcaactattacatgggatactcctgagaatgagggtggtgctcca
gttaagaactaccttgttgatctccgtgaggcaactaaaatgggctggaccagaattaca
gacagttgtccaaggttgacttataaagttaatgatcttcaagaagggggtgtttattat
ttcagagttaccggtgaaaatgagtatggtataggagtcccacttgagaccaaagaagga
acaaagattacagaaaaaccaagtccaccacccaagcttggagtcactgatgtcacaaaa
gacagtgtctcactatcatggcttaaaccagaacatgacggaggtagcagaattacaaat
taccttgttgaggctcttgaaaaaggacaacaaaagtggataaagtgtggatccaccaaa
tcaactcactttgttgtatatggattgagagaaaatgctgaatactacttcagagtccgg
gctgaaaaccatgctggacttagcgaccccaaggacatggttttacctgttcttgtaaaa
gatcagctggaggcacctgaaattaacatgaaggacttccaacacaacactgccttcgtt
aaggcaggttctaatctcaagattgagatccccctcactggtaaaccacaaccaaaagta
tccctatctaaggatggacaggttctaaagtcaaccatgagattcaactctgatgtgaca
actgactcccttataatttatttgcgtgagagtgttgcttcggacgcaggcagatatgat
atcacggcctccaactccagtggaaccacaaagtcttttgtgaatattgtggtccttgac
agaccaagtccaccagttggtcctgttgaaatgtgtgatgtcacagaagatagtgtcagt
ctaaaatggttgcctcctgcttatgatggtggtagcccaatcaccaactacattgttttc
aaacgtgagaccattactgcaaactgggtagaagtctcatctgctgttgcacggtgcaca
atcaagatcatgaagctgattaatggagttgagtaccagtttagaatcagggctgagaat
cgttttggcatcagtgaccacattgattcaccaactgttacagtcagtcttccatacaca
ctccctgtggcaccttcacaaccatgggtatcagctgtaacaaaggaaagtattactgtt
aactggaaggagccatcttcagatggtggaagccatgtatttggatatcaccttcagatg
aaagacagaaacagcattctttggcagaaagttaacacaactgttatccgtgctacacac
ttcaaagtatcaaacgtgaatgctgggctgatctatgagttcaaggttgcagctgaaaat
gctgctggcattggtccagttagcaagtcttcagatcctgtgcttgcaattgatgcttgt
gaatctccgaacaaccttagagtcactgatatcacaaagagttccattagcctttcctgg
gagaaaccctcatatgacggaggaagtaaaattactggatatttgattgaaaggaaagat
ggtccgaaaggcagatggtcaaaagctaatttgacaaatgttactgacacaaagttcact
gtatcaggtttgactcagaatgaatcttatgaattccgggtcatggctaagaatgcagtt
ggctccattagtaacccatcagcaactgttggaccagtcacatgtgtggatacatatggt
gcccctgagattgaatttcctccagaatatcttgatgtggtgaaatacaaagcaggtgct
acagttcatcttaaaattggtattattgctaaacctcaaccaacaattgaatggtacaag
gatggaaaagagcttgagtctggagctcaaatttccatttccaacaccactgagtctgca
tgcatctcaatcagggaagccagccgtttgaatagtggaacgtatgaactcaagatcaag
aattctttaggctcagcatatgctgctgtcagagtacttgtccaagacaagccaggaccc
cctgctggagagatacagttcaagaaaatcacagcagatactatgactatcatgtgggat
cctccagatgatgaaggtggagcaatggttacccactacattgtggagaagcgtgaaaca
agcagaattttgtggtccattatctcagaaaaactagaagactgcattgtcacagtccca
aggctaattaagggcaatgaatacatattccgtgttcgtggtgttaacaaatatggagtt
ggagatcctctggaatctagaccagtaattgcacagaattcctttgttcctcctagtcgg
ccttctaaaccccaagtcactatgattaccaggtcaacaatgactgtggtatgggaaaga
ccaagtttagatggtggcagtgacattgatggatattacttagaaaagcgggagatgaaa
agtctacagtggttcaaggttattaaagatgcaattcgtgataccagacagaaagtcagc
aacctcacagaaggaaatgattatcagtatcgtgtctgtgcaatcaacaaagctggagca
ggcccatattctgatgtgtccatcttttacaaagcttatgacccaattgatccaccaagt
gagccaaccaagctcagagttgttgattcaacaaagacatctattacccttggatgggtc
aagcctgtctatgatggtggcagtgaaattacaagctatgttgttgaacaaagattggca
gatgagaccgagtgggtcactataagttctaaaggagaaataagaacaactgagtttgta
gtgtcccacttgaaacctggagtgtactacttcttccgtgtctctgctgttaattgtgct
ggaactggacgttcaattgagatgatgcagccagtgcaagccaaagatattctggaggag
gcggatgtggatcttgacatctcaatgtcgactcagtacatagcaaaggctggtagagat
gtggagattgtaatccctcttaagggtagacctgctccaaatgtaacatggagaaaggga
gacaaaaacattagtggtgacgcaagatatgccatcagaaacacagaatactcaactaca
ctcataattccaaaggtcacaagggatgatactggcaaatatcttcttgaaattgaaaat
ggggttggagagccaaaaaccatcacggtgtctgttaaagtattagacacaccttctgct
tgtaataggttgatagtgaagaatgtgacacgaggtaaacttactttgagctgggaacca
ccttatatagatggtggctctccaatcacaaactacgttgttgaaaagaaggatgctaaa
atgaaggcattcaccattgtgacaaatgaatgtgccaatacaacctacaaggttgatggg
ctgtctgaagaaatttcctatttcttccgtgtttctgctgaaaatgaatatggtgttggt
gatccttgtgagactgcacagcctgttagagcaaccgagatgcctggtgctgtaaaagac
cttgtactggtggactcaactaatacttctgtatcgttggcatggacaaagcctgatcat
gatggtggcagtcacatttctgagtacattattgagaagaaaacaaaggaagaggaagct
tggagcatcggtggtacgtgcaggcgttgccagtatgaggtaactcaccttaaagagctt
tcagaagtttactttagagtattggcaaaaaatgagaagggttgcagtgacttctctcaa
attggacccatcactgtaaaggaactccttataccacctgaggcaaaccttattgactat
cctaattcagaattaagtgttcgcattggacaaaatgtgaatattgatttgccctacaag
ggtaaacctaaaccaacgattcagtggatgaaagatgacgtgccactcaaggaaagtgag
caagttcgtttcagacaaacagagaacaaggcaagtctcattgtaagaaatgcaagaaag
gagaatgcaggaaaatacaccttggtccttgatagtaaacttgtcaagaacttctttgac
attaaagtcattacacttgggccaccctctcagcctataggtccaattcgttttgatgaa
attaaagcccagagtattatcatctcatgggatgaaccccaggacaacggtggaggcgag
atcacctgctatagtgtagaaaagcgagagacatctcaagcagcatggaagatggtttgc
tctagtgtggtcaggaccacattcaagataccaaatttggttaagggtactgaataccaa
tttagggtgcgtgcagagaacaaatatggaatgagcgagcctctaacctcattagatgtg
gttgctcaacaccaatacaagccaccaggttcaccaggaaaacctgtagtattcaatgtt
acaagtgatggcatgactgttcagtgggaagccccaggatttgatggcggttctccaatc
actggataccatcttgagaaaaaagacaggaacagcttattgtggatgaaagtgaattcc
agtgttatctctggaagagaatacagagtcattggacttattgaaggtctggagtattca
ttcagggtttatgcacaaaacaatgctggaatgagtccagtcagtgaacagagcaagcac
aaactggcaatctcccctgttgatcctccaggcacacctaactgcattgatgttacaaga
gactctgtaacacttcagtgggaaccaccaaagcgtgatggaggcagtaggattgtggca
tacagtgttgaaaggcgtcaaggaagagcccgttggttgagatgcaatttcattgacatc
agcgaatgtcagtttactgtaacaggccttcctgctggtgatcgctttgaatttagggta
atagcaaggaatgctgtcggaacagttagtccaccttctcagtcatctggctacatcatg
accaaggatgaatgtgttatccctgagattcagtttgaagctgagaagaccctcaccatc
aaggcaggagaaaatattaaactcaactgcagtataagtggacgtcctgtacctcaagtc
acatggtataaagatggaaaggaagttgataaaatgctggttgacatcacaactgttatt
ggatcaagctcactgttcatcagagatgctgaccgcaatgaccgtggtatctacacagtt
gaggccaagaacagttcaggcacaacaaaagtggatgttcttgtcagagtacaagatacc
cctggaccacctgagggcccgcttcgcttcacaaatatatctgcagagaaagcaactctt
tggtggagcccacctgaaaatgatggttgtgcacctatcattaattacgtaattgagaag
cgtgaaacttccagaatttcctgggcacttgtaacatccaagtgtgaagcctgctccttt
aatgccacaaaactgattaaaggcaatgaatatcagttccgtgtatctgctgtcaataaa
tttggtgtgggcaagccactagagtctgatccaattattgctcagatgcaatatacggta
ccagatgctcctggaacacctgactgcactcatgtgacaggaaacagtatcactctatgc
tggacaagaccaagacatgatggtggaaatgagattaagcaatacattcttgaaagacga
gaaaagaagagcttaagatgggtgaaggtttctgcaaagagaccagtaactgagcttagg
catagagtaacaaaccttacagaaggaaatgaatacgaattccgtgttatggctgaaaat
ggtgctggaattggacctgcaagtggtacatccagattgttcaagtgcagagaaccaaca
agtgcacccagtgcaccaactgtggtgaaggtcattgattccaccaagatgtctgttacc
ttggaatggaccaaaccagtgtttgatggtggtatggaaataattggttacattattgag
atgtgcaaggcaagccttgaggaatggcacagagtcaacaaccagacttgcatccacaca
cattacacagtaacagagttagaacctggtgaagaatataaattccgtgtgtgtgctgtc
aatggtgctggcaagggagaattctctgagactccaaatgtagtgcaagcagttgataga
ctgacttcacctgaaattgatatagatgcaaacttcaagcagacacatgttgtgaagagc
ggcggaacagttacacttcatattcccttccgtgggaaaccagccccacttgccacatgg
acaaaggcagatggagatcttggtgtaatggtggatattaataccacagaaacattcagc
actttgacaattgaaaattgcaccaggtatgatgctggcaaatatacactctctcttgaa
aacaacagtggtcgtaaagccattacattaacagtcaaagtgctggacacacctggccct
cctggacctctctcattcaaggatgtaacaagaggtgctctgacactcatgtgggatgca
ccatccaatgatggaggtgcacgtgttcatcactacattgttgaaaagcgagaggcaagt
cgattaagttggcaagaggtcagtgaaaagtgtacacgtcaaatattgagagtggccaac
cttgatattggtgtagcatatttcttcagggttattgctgaaaatcagtatggcaaaggt
gagccatttgaaatgacagaacctattatagccacagaagagcctgcacctcctaagcga
ctggatgtcattgatactacatcctcaacagccagtttagtatggatgaagcctgagcac
gatggtggaagccgcattactggatacattgttgagactagaaagaagggttctgatcac
tgggttgtaggtggtcagaccaaatctttaaaaatggttcttgaaggcttggttgagaac
acagaatatgagttccgtgttaaggctcagaatgatgctggcattagtcagccacgagat
gccctagcctctgtcatcataaaggagccacgtatagagccaacagcagatctcagtggc
attgataaacagctcatcacttgcaaaactggaaattcctttgcaattgatattccaatc
agtggcagaccagcccctaaggtaacatggaagcttgaagaaatgaaacttaaagaaaca
gacagagtgtcagttaagatttcaaaagacagaacaactctactggttaaggatgccaag
agaggcgacagtggaaaatactatctcacacttgaaaatgtagctggatcaaaaacattc
actgtcattgtcagtgtcattggtagaccattgccaccaactggacctgttgaaatttca
ggaatatcatcagaatcctgtgtattgacttggggagaacctgcagatgatggtggaaca
gacataaccaattatattgttgagaaacgtgagtctggctccacaacatggcaggttgtg
aattccagtgttaaacggaccaccatcaaagtaactcatctcacgaagtacatggagtac
actttcagagtctgtgctgagaacaagtttggtgttagcaagtctattgaatctcaagct
attgttgctgagcatccattcatctcaccaagccctccaactcgcccagatgtagtttca
gtgtctgctaatgcaatttctatccgctgggatgtgccatatcatgatggtggaagccaa
gtaactggatactggattgagaaaaaggagcgtaataccattctgtgggtgagggagaac
aagattccttgccttgagtgtcactacaaggtttctaaccttattgagggcctcgagtat
cagttcagagtatatgcaatgaacatcgctggtctgagtaaagcaagtgaaccatcaaga
ccagtactggctctaaatccagttgatccacctggcaaaccagaggtttatgatgtaacc
aagacatcagtgtctattagatggtctataccattcaatgatggtggcagcaagatcgtt
ggatatgtggttgaacgcaaggcattaggtgatgatgaagaagctcgttggttgaagtgc
aactacactacaatcacagaaaacgtatttactgttacttcactcagtgagggagagcag
tatgaattccgtgttattgccagaaatggtgctggagtccacagtatgccatctgaatca
acaggacttatcacatgcaaagatgaatatacaccaccaaaggctgagctcgatagtaaa
cttgtgggtgagacgatcactattagagcaggatcagacctggttcttgatgctgctgtt
ggtggaaaaccagagcctaaggttttttgggccaagggtgacaaggagctggaactcgga
gagaaatactcactgacatacacaagtacaagagcgatggcaatcattaagacatgtgat
agaaatgatactggtagatacatccttactgtgaagaatgcaagtggaatcaaaacagct
gctgtcaatgttaaagtacttgatacacctggtccacctgagggtacaataacaattagc
agggtcacagaagagaaatgcacagtttcctggaagattccaatggaggatggtggagat
cgtgtcactcactatattgttgaaagacgtgagaccagcagactcaactgggtcatcatg
gaagctgaatgcaagactctgtcttgtgtcagcacaaaactgatcaagaacaatgagtac
attttccgtgtcagaggtgtaaataagtatgggcctggtgtacccttagagtctgaacca
gttattgcaagaaatgcttacactgttccaacacctccggaagcaccagtgattactgct
gttggaaaagaacatgtcattattgagtggctgaagccagagagtgatggcggaagtgaa
atcaaaaactaccttgtggataaacgtgagacgagtagtgttagatggacaagagtgaac
aaaacctacaccatttatgatacacgcctcaaaatcactggtctccttgagggtagcgat
tatcagttccgtgtttcagctgtcaatgctgctggcaccagtgttccaagtgatgcatct
cagtacgctcactgtagagacccaacatatactccagctccaccatcagttcctcgtgtt
acagacaccacaaagcacagtattagtataacatggtcacgaccaatgtatgatggtgga
tccgatgtcacaggctatgttgttgagattctggaggagggaacagagcaatggtataga
gccactcagaagatactgacaagtactcagtacacagtagctggtctggcaagtaataaa
aagtacagcttcagagtggcagcagtcaatgctatgggtactggagagttcagtgaaggc
agtattgaggctgcaccttcagaaagagtcgaaattcctgatattgagctacctgacgaa
ctgaagaagactgtttgcatcagagctggcaacactttacgtcttcatgtaactacagct
ggaagacctgcaccagttgttacctggagaaagcctggaattgacctacaatcccgtgga
ttcatagatactacagaaaacactacaactttaatagttgagaaggttcatcgttatgat
gctggaaaatacacaattgaggcagaaaatccatctggcaagaaaatagttaccattctt
gtcaaggtttatgatactcctggaccatgtggtgcagtaaatgttaaagattacactaaa
agagtctgttgtaatcacatgggatgtgcctactgttga

DBGET integrated database retrieval system