KEGG   Cyprinus carpio (common carp): 109101296Help
Entry
109101296         CDS       T05134                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109101296
Membrane trafficking [BR:ccar04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109101296
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109101296
NCBI-ProteinID: XP_018970234
Position
26
AA seq 153 aa AA seqDB search
MVKSMSHHLFLSSRLDLPRRQRFPDRFVDDIAALVCAISADIASRYHKDVELVERLNSSL
AFFLNDLLSLMDRGFVFNLIRSYYKQINNKLHTAQNPSSLTALRMDFIRIVCSHEHYVTL
NLPCATLSPPASPSPSTSSTTSQVQVKLPQKIA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagagcatgtcccatcatctgttcctgtcctcgcgcctggacttgccccgacgc
cagcgcttccccgaccgctttgtggatgacatcgctgccttagtgtgtgccatcagtgca
gacatagccagcagatatcacaaggatgtcgagctagtggagaggttaaacagcagcttg
gcctttttcctcaatgacctgctgtctctcatggacagaggctttgttttcaacctcatc
cgctcgtattataaacagattaataataagctccacacagcgcagaaccccagctctctg
acagcgctgaggatggacttcatacggatcgtctgcagtcacgagcactacgtcaccctg
aacctgccctgcgccaccctcagtccccccgcgtccccctcaccctccacatcctccacc
acctctcaggtacaagtcaagctaccacaaaaaatagcttga

DBGET integrated database retrieval system