KEGG   Cyprinus carpio (common carp): 109101721
Entry
109101721         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: hypoxia-inducible factor 1-alpha-like
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109101721
   04137 Mitophagy - animal
    109101721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109101721
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109101721
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 HIF-1 PAS PAS_9 PAS_4 Cas_Csn2 HLH
Other DBs
NCBI-GeneID: 109101721
NCBI-ProteinID: XP_018970672
Position
27
AA seq 774 aa
MDSGVVTEKKRVSSERRKEKSRDAARSRRGKESEVFYELAHQLPLPHNVTSHLDKASIMR
LTISYLRMRKLLSSDEEEKENELECQLNSFYLKALEGFLMVLSEDGDMVYLSENVSKSMG
LTQFDLTGHSIFEFSHPCDHEELREMLVHKTGSKKTKEQNTERSFFLRMKCTLTSRGRTV
NIKSATWKVLHCAGHVRVQERSEASGDLGFKEPPLTYLVLICEPIPHPSNIEVPLDSKTF
LSRHTLDMKFSYCDERITELMGYEPDDLLNKSVYEYYHALDSDHLTKTHHNLFAKGQATT
GQYRMLAKKGGFVWVETQATVIYNPKNSQPQCIVCVNFVLSGIVEGDVVLSLQQTVTEPE
AEEKENQEMEDEASEVDILKLFKPESLKCPMESSDLYEKLKEKPEALTVLAPAAGDTIIS
LDFNNSDSDMQLLKEVPLYNDVMLPSSSKKLPICLSPLTPSDSAPVLTKLDTGAEDFPFS
SASDRGPDSANTPSTSGLGSSGPNSPMDYCFQVDSDISSEFKLDLVEKLFATDTEAKTPF
SSQAMEDLDLEMLAPYIPMDDDFQLRIPSPLDPLPSGPHSVSAMSSLFQPLPSPASPASS
SSSVVKQEPSSRAPSPLHLLQEVCSAPVSPFSGSRDVSPLXAPAPQSSNQLNNRELSPKM
LAIQNAQRKRKLEEVTSLCEAVGLGALLQSVDSAIEPGKRAKVLEVKGSSVLGGNKTILI
LPSDVASRLLCSSLEGSGGLPQLTRYDCEVNAPVQDRHHLLQGEELLRALDQVN
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggatagtggagttgtcactgaaaagaaaagggtgagctcggagcgcaggaaggagaag
tccagggatgcggcgcgatctcgcaggggaaaggagtccgaggtgttctacgagttagca
caccaactccctctgccacacaatgtcacctcccacctggacaaagcctccatcatgcgg
ctgaccatcagctacctgcgcatgaggaagctgctgagctctgatgaagaagagaaggag
aatgaactggaatgtcagctgaacagcttttatctgaaggccttggagggtttcctcatg
gtcctgtctgaagatggagacatggtttatctctctgagaatgtcagcaagagcatgggc
ctcacacagtttgatctgactggtcacagcatctttgaattttcacacccatgtgaccat
gaggagctgagagagatgctggtccataagaccggatccaaaaagaccaaggaacaaaat
acagagcgcagcttcttcctgcgtatgaagtgcacactcactagcagagggcggactgtc
aatatcaagtctgctacgtggaaagttcttcactgtgctggtcatgtccgtgtgcaggag
cgcagcgaggcttcaggagacttgggctttaaagagcctcctctgacctaccttgtgctc
atctgtgagcccattcctcatccctcgaacatcgaggtgcctctggacagcaagaccttc
cttagccgccacactctggacatgaagttctcgtactgtgatgaaaggatcacagagctg
atgggatatgagccagatgatctgctgaacaagtctgtgtacgaatactatcatgccctg
gattcagatcacctcaccaagacacatcacaacttgttcgccaagggccaggccaccaca
ggccagtaccgcatgctggctaagaaaggtggttttgtgtgggtggagactcaggccact
gtaatctacaaccccaagaattctcagccacagtgcattgtgtgtgtcaacttcgttctc
agtggcattgtggagggggatgttgtcctgtccttgcagcagactgtgacagagcccgag
gctgaagagaaagagaaccaggagatggaagatgaggcctctgaggtggacatactcaaa
cttttcaagccagaaagcctcaagtgtcccatggagagctctgatctttatgagaagctg
aaagagaagcctgaggcacttactgtgttggcgcctgctgcaggagacaccatcatctct
ctggacttcaacaactcagattctgacatgcagctgctgaaggaggtgcccctctacaat
gatgtcatgctgccctccagcagcaagaagctgcccatctgtctgtctcctctgacgccc
agcgactctgccccagtcctgaccaaactagacaccggagcggaggacttccctttcagc
tctgcctctgatcgtggtccagactccgcaaacacaccttccacatctggactgggctcc
tcggggccaaacagccccatggattactgtttccaagtagactcagacatcagttctgaa
ttcaaactggacctggttgagaaactgttcgctactgatacagaggcaaagacccctttt
agctcccaggccatggaggatctcgacctagagatgctggctccatacattccaatggat
gatgacttccagctgcgtatcccctctccgctggatccgcttccctctggccctcactct
gtgtcagccatgagctccctgttccagcccttaccctcccctgcatctccagcctcttcc
tccagcagcgtagtgaagcaggagccgtcatcacgggccccttcacccctgcacctgcta
caggaggtgtgcagtgcccctgtctcacccttcagcggcagtcgggatgtttcccctctc
nnggcccccgccccacagagcagcaatcagctcaacaacagagagctgtcaccaaagatg
ttagccatccagaatgcccaacgtaagaggaagttggaggaagtgacatcactttgtgag
gctgttggactgggtgctttgcttcagagtgtggacagtgctatagagcctggaaagagg
gcaaaggttttagaggttaaaggatcgagtgtgcttggaggaaataaaaccattctcata
ctgccctctgatgtggccagtcgcctgttgtgcagttctttagagggcagcggcgggctg
cctcagctaacacgttacgactgcgaagtcaacgctcccgtgcaggaccgccatcatctg
ctgcagggagaggagctcctgcgtgctctggaccaagtcaactga

DBGET integrated database retrieval system