KEGG   Cyprinus carpio (common carp): 109102481Help
Entry
109102481         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00790  Folate biosynthesis
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109102481
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     109102481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase
Motif
Other DBs
NCBI-GeneID: 109102481
NCBI-ProteinID: XP_018971371
Position
28
AA seq 237 aa AA seqDB search
MAAANRVLVYGGKGALGSACVHYFKSKGWWVASIDIVANEEANANVLVKLCESFTDQAAQ
VTSDVATLLGEHKVDAIVCVAGGWAGGNCSSKDLYKNSDMMWKQSVWTSTISSHLASLHL
KPGGLLTLSGAKASLEGTPGMVGYGMAKAAVHQLCKSLAGENSGLPSGAVAVAILPVTLD
TPMNRKFMPDADIGSWTPLEYIAETFYSWATGSGRPASGSLIQLVTTGGETEASAAQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcgaaccgtgtccttgtttacggaggaaaaggagctctcggctcagcatgt
gtgcattattttaagtcaaaaggctggtgggttgccagcattgacatcgtagcgaacgaa
gaagcgaacgcaaacgtcctggtgaagctctgcgagtcgttcaccgatcaagccgctcag
gtgacatcagatgtagccacattgctgggggaacacaaggtcgacgccattgtttgtgtg
gcaggaggatgggccggaggaaactgtagctcaaaagacttgtataagaactctgatatg
atgtggaaacagagtgtctggacctccaccatttccagtcatcttgcatcgctccatctg
aagccaggaggcctgctgaccctctctggtgcaaaggcctcactagaaggcactccaggt
atggttgggtatggcatggccaaggctgcagtccatcagctctgcaagagtctggctggc
gagaacagtggccttccatctggagctgtagctgtggccattcttccggttaccttggat
acaccaatgaacaggaaattcatgcctgacgcagatattgggagctggacaccactggaa
tacatcgcagaaaccttctacagctgggccactgggtcaggccggccagcctcaggcagc
ctcatacagctggtgactactgggggggaaaccgaggcctcagcggcccagtaa

DBGET integrated database retrieval system