KEGG   Cyprinus carpio (common carp): 109102730Help
Entry
109102730         CDS       T05134                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109102730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109102730
Ion channels [BR:ccar04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   109102730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 109102730
NCBI-ProteinID: XP_018971643
Position
28
AA seq 290 aa AA seqDB search
FHRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLD
AGSTKEFFRRSKIAVFEKMWSYMKSADPSVFVKTTDEGVIRVRKSKGKYAYLLESTMNEY
IEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRIPVNLAVLKLSEQAVLDKLKNKWWYDKG
ECGSKDSGRKDKTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSRTESHRMKQSIND
AMRCSTLTRMSGNGSGGENGRIVTHDFPKAVQTLPCMSHGASMGLGASGM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttccacaggtctctctctggccgtatcgtgggtggtgtgtggtggttcttcactctgatc
atcatctcctcatacacagccaacctagctgcgtttctcacagtggagaggatggtgtca
ccaatcgagagtgcagaggatctggctaaacagactgagattgcttatgggactctagat
gccggttccactaaagagttcttcagaaggtcaaagatcgcagtatttgagaagatgtgg
tcctatatgaagtctgcagacccctcagtgtttgtgaaaaccacagatgaaggagttata
cgggtgaggaaatccaaagggaagtacgcctacctgctggagtccaccatgaatgagtac
atcgagcagcgcaaaccctgtgacactatgaaggtcggaggaaacctggactccaaaggc
tatggcatcgccacccccaaaggatcccctctcagaatcccagttaacctagcggtgttg
aaactcagtgagcaagccgtcttagacaaactgaaaaacaaatggtggtacgataagggg
gagtgtggaagcaaggactccggaagaaaggacaagaccagtgctcttagcctcagcaat
gtggctggggttttctacattctgatcggcggtctgggtctggccatgctggtggccctg
gtggagttctgctacaagtccagaacagagtcccacagaatgaagcaatccatcaatgat
gccatgcgctgctccacgctgaccaggatgagcgggaacggtagcggcggggagaacggg
cggattgtcacacatgacttccccaaagctgtgcagacgctgccgtgcatgagccacggg
gccagcatgggcctgggagcctctggcatgtga

DBGET integrated database retrieval system