KEGG   Cyprinus carpio (common carp): 109103379
Entry
109103379         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109103379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109103379
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    109103379
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_11 zf-C2H2_jaz zf-C2H2_6 zf-BED PyrI_C zf-Di19 DUF3268
Other DBs
NCBI-GeneID: 109103379
NCBI-ProteinID: XP_018972331
Position
29
AA seq 852 aa
MHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAAAGGLFAQGMALPGTPGLDKS
ALAGMSHGSPGLADYFGANRHHGGLTFPAAPPAFPFSFPGLFPSGLYHRPPLIPSTSPIN
GPPSGELRKSPLLSSPISGSHDLLKSLRKDSFNGESESVEHQREGSVSKPRHGGKMSDQS
ESSDLDDVSTPSGSELESTSGSELDSEAESDRERVRVRENGKGPKRKSSGFKDAQSPTLV
SSSSSSNTNNGKDFPVPGLLPPSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGLQDK
KVGALPYPSMFPLSFFPAFSPSVYPFPEREQLRPPGHKREPESPPVEGKKLQGRNAESPF
DLTTKRKEEHLAATCASLKPEASHVQSVNQDQPLDLSLGGRSRGKGVRGEELKKNPVFGE
ERVEPGPPKADPSLQHARPTPFFMDPIYRVEKRKMNDPFEVLKDKYMRPAPGFLFHPQFR
MPDQRTWMSAIENMAEKLESFSSLKPDGGDIMRSIPSMFDFRAPPTTLPETLLRKGKERY
TCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCH
LCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPRSELDSGSAILEDKEDSYFTEIRNFISN
TAQNATSPSHSEEGMNGSHFDGDKALPGQGSRDLDEENGRKLGAEEEEVEHSDSARKPSE
DGVPSSLDHDINDDIDFEGPDDLEMNSKSSPQRFNEDDDDEDHSSFSTLDHIRHFSMEDG
DLSDSDVTSFGPAHLQEGIKQPLYRKSKSQAYAMMLSLADKDPLHSSTHNAPMWHSLARA
AEPSAIQSLSHV
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgcacgcagactgtcgcactcagatcaagtgcaaagactgcggccagatgtttagcacc
acgtcgtccctaaacaagcatcggcgcttctgcgagggtaaaaaccattttgctgctgcc
gcgggagggttgtttgcccagggtatggcgctccctggcacccctggcctggacaaatcc
gcactggctggaatgagccatgggagtcctggtttagcagactatttcggggcgaaccgg
caccatggtgggctgacattcccagcagcccctccggcattcccattcagttttccagga
cttttcccatcaggactttaccaccggccccctctaatcccatccacgtcacctattaat
ggccctccgagcggtgaactacgaaagagtccgctgctgtcttcacccatctctgggtca
catgacctcttgaagagtttacgcaaggattcgttcaatggggagagcgagagtgtggag
catcaaagggaaggatccgtctccaaaccaaggcatggcgggaagatgagcgaccagtcg
gagagtagtgatctggatgacgtcagcactccaagcgggagtgagctggaaagcacttca
ggttcagagttggacagcgaagcagaaagcgaccgggaacgggtgcgagtgcgggagaac
gggaaaggcccgaaaaggaagtccagtgggttcaaagatgcccaaagcccaactcttgtc
agctctagtagtagtagcaacaccaataacggaaaagacttccctgtgccggggctcctc
ccgccatctttggacgagcaaacggctgtttccggtgccgttaatgactcgatcaaggca
attgcctccattgctgaaaaatactttggttccactggacttgcaggcctgcaagataaa
aaagttggggcattgccatacccttccatgttccctctgtctttcttccccgccttctct
ccatcagtctatcctttcccagaaagggagcaacttagacctccaggccacaaaagggag
ccagaaagccctccggttgagggtaaaaaacttcagggaaggaacgctgaatcacctttt
gacctcaccaccaaacggaaggaagaacatcttgccgctacttgcgcctctttgaaaccg
gaagcctcacatgtacaatcagtcaatcaggatcaaccgctggacctgagtctcggtgga
cgaagtcgaggaaagggtgtaagaggggaggagttaaaaaagaaccctgtctttggagag
gagagggtggaaccagggccacccaaggccgacccgtccctccaacacgcaagacctaca
cctttcttcatggatcccatttacagggttgagaagagaaagatgaacgatcctttcgaa
gtcctcaaggacaagtatatgcggccggctcctggatttctcttccacccacagtttcgc
atgcctgatcagagaacatggatgtcagcgattgaaaacatggccgaaaagctagaatcc
ttcagctctttgaagccagacggcggtgacatcatgcgttccattccctccatgttcgac
ttccgggctccgcccaccacccttcctgagacactgttacgcaaaggcaaagagcgctac
acctgcagatactgtggcaagatattcccacgctcagccaaccttacaagacatctacgg
acacatacaggagagcaaccttacagatgtaagtactgcgatcgttcgttcagtatttcc
tcgaatcttcagcgtcacatccgtaacatccataacaaagagaaaccctttaaatgccat
ctttgtgaccgctgcttcgggcaacaaaccaacctggaccggcacctcaaaaagcacgag
aacggtaatttatcaggcacggcaatgtcgtcgccgcgttcagagctggacagtggcagt
gccatcttggaggacaaggaggactcgtattttaccgaaatacgaaacttcatcagtaac
acagcacagaacgccacgtctccgtcacactctgaggaagggatgaacggcagtcatttt
gatggcgacaaagccctgcctggtcaggggtcacgtgacctggatgaagagaacgggagg
aagcttggagcagaggaagaggaggtggagcatagcgacagtgccaggaaacccagcgag
gatggcgtgcctagcagtctggatcatgacataaacgatgacattgatttcgagggacca
gatgatctagagatgaatagcaaatcctcgccacaaaggtttaatgaggatgatgatgat
gaagatcacagcagtttctccacgctggatcacatccgtcactttagtatggaggatgga
gacctcagcgacagtgatgtcaccagctttggccccgcccaccttcaagaaggcatcaag
cagcctctatacaggaaatctaagtcacaggcatatgctatgatgttgtctctagctgat
aaggatccactccattcgtctacccataatgccccgatgtggcacagcttggcccgcgcc
gcagaacccagcgccattcagtctctcagtcacgtatga

DBGET integrated database retrieval system