KEGG   Cyprinus carpio (common carp): 109103380
Entry
109103380         CDS       T05134                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109103380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109103380
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    109103380
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_8 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 Zn-ribbon_8
Other DBs
NCBI-GeneID: 109103380
NCBI-ProteinID: XP_018972332
Position
29
AA seq 769 aa
MKAEEFSCETMAPDIHEERQYRCEDCDLNFESGSELLDHQKHACGTPPSSGFKLSKQGLP
STADDPDLDPLHFHTHPLNLPHSPQECKECEQVFPDAQSLDTHSLSHSDEREYKCDQCPK
AFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTF
ATSSGLKQHKHIHSSVKPFICKSLRPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKD
CGQMFSTTSSLNKHRRFCEGKNHFAAAAGGLFAQGMALPGTPGLDKSALAGMSHGSPGLA
DYFGTNRHHSGLTFPAAPPAFPFSFPGLFPSGLYHRPPIIPSRSPINGPPSGELRKSPLL
SSPISGSHDLLKSLRKDSFNGESVERQREGSVSKPRHGGKMSDQSESSDLDDVSTPSGSE
LESTSGSELDSEAESDRERVRVRENGKGPKRKSSGFSDAQSPTLVSSSSSSNTNNGKDFP
VPGLLPSSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGALPYPSMFPLSF
FPAFSPSVYPFPEREQLRPPGHKGEPESPPVEGKKLQGRNAESPFDLTTKRKEERLAATC
TPLKPEASHVQSANQDQPLDLSLGGRTLGKSVRGEELKKNPVFGEERVEPEPPKADPSLQ
HARPTPFFMDPIYSRVEKRKMNDPFEVLKDKYMRPAPGFLFHPQFRMPDQRTWMSAIENM
AEKLESFGSLKPDGGDIMRSVPSMFDFRAPPTTLPETLLRKGKERYTCR
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgaaggctgaggagttttcatgtgagaccatggctccagacatacacgaggagcgtcag
taccgttgtgaggactgtgacctgaactttgagtctggttcagagctgctggaccatcag
aagcatgcatgcggtaccccgccttcatccggcttcaagctgtctaagcagggtctgccc
agcaccgcagacgatcctgatcttgacccactgcacttccacactcaccccctgaactta
ccccattccccacaggagtgtaaggagtgtgagcaggtctttcctgatgcccagagtctg
gacactcactctctgtctcactccgatgagagggaatataagtgtgatcagtgtccaaag
gccttcaactggaaatcaaacctgattcgccaccagatgtcacatgacagcggcaagcat
tatgaatgtgaaaactgctcaaagcaggtgttcacagaccccagtaacttacagaggcac
atccgctctcagcacgtgggggcgcgagctcacgcctgccccgactgcggcaagaccttc
gccacctcctcgggccttaaacaacacaaacacatccactcttccgtcaagcccttcata
tgtaagtcactcagacccttcatatgtgaggtctgccacaaatcttacacacagttctcc
aatctgtgccgccacaaacgcatgcacgcggactgtcgcactcagatcaagtgcaaagac
tgcggccagatgtttagcaccacgtcgtccctaaacaagcatcggcgcttctgtgagggt
aaaaaccattttgctgctgctgcgggaggattgtttgcccagggcatggccctccctggc
acccctggcctagacaagtccgcactggctggaatgagccatgggagtcctggtttagca
gactattttgggacgaaccggcaccatagtgggctgacattcccagcagcccctccagcc
ttcccattcagttttccagggctttttccatcaggactttaccaccggccccctataatc
ccatccaggtcacccattaatggccctccgagtggtgaactacgaaagagtccgctgctg
tcctcacccatctctgggtcgcatgacctcttgaagagtttacgcaaggattcgttcaac
ggggagagcgtggagcgtcagagggaaggatctgtctccaaaccaaggcacggcgggaag
atgagcgaccagtcagagagtagcgatctggacgacgtcagcactccgagcgggagtgag
ctggaaagcacttcaggttcagagttggacagcgaagcagaaagtgaccgggaacgggtg
cgagtgcgggagaacgggaagggcccaaaaaggaagtcaagtgggttcagtgatgcccaa
agcccaactcttgtcagctccagtagtagtagcaacaccaataacggaaaagacttccct
gtgccggggctccttccatcatctttggacgagcaaacggctgtttccggtgccgttaat
gactcgataaaggctattgcctccattgctgagaaatactttggttcaactggacttgca
ggcctgcaagacaaaaaagttggggcattgccatacccttccatgttccctctgtctttc
tttcctgccttctctccatcagtctatcctttccctgaaagggagcaacttagaccccca
ggccacaaaggggagccagaaagccccccagttgagggtaaaaaacttcagggcagaaac
gctgaatcaccttttgacctcaccaccaagaggaaggaagaacgtcttgcagccacctgc
acccctttgaaaccggaagcctcacatgtacagtcagccaaccaggatcaaccgctggac
ctgagtcttggtgggcgaactctaggaaagagtgtaagaggggaggagttaaaaaagaac
cctgtctttggtgaggagagggtagaaccggagccacctaaggccgacccttccctccaa
catgcaagacctacgcctttcttcatggatcccatttacagcagggttgagaaaagaaag
atgaacgatcctttcgaagtcctcaaggacaagtatatgcggccggctcctggatttctt
ttccacccacagtttcgcatgcctgatcagagaacatggatgtccgcgattgaaaacatg
gccgaaaagctggaatcctttggctctttgaagccagacggcggtgacatcatgcgttcc
gttccctccatgttcgacttccgggctccgcccactacccttcctgagacattgttacgc
aaaggcaaagagcgctacacctgcaggtaa

DBGET integrated database retrieval system