KEGG   Cyprinus carpio (common carp): 109103773
Entry
109103773         CDS       T05134                                 

Definition
(RefSeq) hypoxia-inducible factor 1-alpha-like isoform X1
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109103773
   04137 Mitophagy - animal
    109103773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109103773
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109103773
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HIF-1 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 109103773
NCBI-ProteinID: XP_018972661
Position
30
AA seq 635 aa
MVNSVMKRPSLEQRKVRSRDAARSRRSQETEVFYELAHSLPLPRRIASHLDKAAIMRVTL
SYLRMNRLIQSAGPAKTQTEETENPTDAFYQQALAGFILVMTEEGDLVFLSESVSKYIGM
TQLELLGQSVYEFVHPCDQEELRDILTTRPGVSKKKTEKLTEHNFFLRMKSTLTHTGRTV
NIKSANWKVLHCTGHMQTFSGDDENSPPAGSFLILLCEPIPHPSSVEFPLDSSTFLTRHN
MDLTFTQCDGRVTELVGYQPDDLIGRSAYEFYHALDFDHVTRSLHILFSKGQVCTSHYRF
LAKNGGFVWTETQATVLYNSRTSQPEAVVCLNFILSGVEEADVVFSLEQTCEKPKPRAEK
LSMLEKEEEEEKDSDMEEESDTATLFLQMKDNPEELMQLAPHSGDTIISLKECVELSFCS
PPSPNTLPESPQDLCTPELRQLLSPIFDRPTNSPPAASPAEELPMETEGVEKFFALKPEE
SITLKGQSEAMDELDLDMLAPYISMDDDFQLTFLPQSEMAVPSDMLTNTSRKRCLEDEEE
DDIPVLAAKWEKKTKSGSIEEELLLSHTLLNTLSEDGSEEFEPPPQKRSQLLTDRDPLLG
GAQALCDTAALMRDSFLSRPPDLMRPAAAAMPSLT
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggtgaactccgtgatgaagaggcccagtttggagcagcggaaggtgcgttcacgtgat
gcagcgcgcagtaggagaagtcaggagactgaggtgttttacgaactggcccactcacta
ccccttccacgacggatcgcctcccacctggacaaagctgccatcatgagggtgacactc
agctatctgcgcatgaaccgattgatccaatcagcagggccagccaaaacacagactgaa
gaaactgagaatcccactgatgccttttatcagcaggcactggcaggctttattctggtg
atgactgaggaaggggacttggtcttcctctcagagagtgtcagcaaatacatcggcatg
acacagctggagctgcttggacagagtgtgtatgagtttgttcatccctgtgaccaagaa
gaattgcgagacatcctcaccacaagacctggtgtttcaaagaaaaagacagagaagttg
accgaacataattttttccttcggatgaagagcacactcacccacacaggaagaacagtt
aatatcaagtctgcaaactggaaggtccttcattgcacaggacacatgcagacgttcagt
ggcgatgatgagaactcgccccctgctggcagcttcctgattttgctttgtgaacccatt
cctcacccctccagcgttgaatttccactagacagcagcaccttcctcacacgccataac
atggacctgactttcacacaatgtgacggacgagtcactgagcttgttggatatcaaccc
gatgatctgattggccggtctgcctatgagttttatcacgcccttgattttgatcatgtg
accaggagtttacacatcttgttctccaagggccaggtgtgcaccagccattaccgcttc
ctggctaagaatggaggatttgtctggactgagactcaagccactgtcctctacaacagc
aggacctctcaacccgaggctgtggtctgcctcaactttatcctcagtggtgtggaagag
gcagatgttgtgttctcactggaacagacctgtgagaaaccaaagcccagagctgagaag
ctgagcatgctggagaaggaggaggaggaggagaaggactcagacatggaggaggagagc
gacactgcgacgctcttcctccagatgaaggacaacccagaagagttaatgcagctggca
cctcactctggagacactatcatttccctaaaagagtgtgtggagttgtcattctgcagt
ccacctagtcccaacactcttccagaaagccctcaggacctctgtacgcctgaactccgc
cagctcctttctccaatattcgacaggcccaccaattctccacctgctgcgagccccgct
gaagagctgcccatggagacggaaggggtggagaagttcttcgccctcaaacccgaggag
agcataactctgaaaggacagtcagaggctatggatgagcttgatctggacatgttggct
ccatatatctccatggatgatgacttccagttgaccttcctgccccagagtgaaatggct
gtgccttcagatatgctgaccaacacttcaaggaaacgatgtttggaagatgaggaggaa
gatgatattcctgttctggctgccaaatgggagaagaaaacaaagagcggctccatagag
gaagagcttttgctcagccacacattactgaataccttgtccgaagatggttcagaagaa
tttgaaccaccacctcaaaagcgaagtcagctcttgaccgacagggacccgttgctgggt
ggagcgcaggccttgtgtgatacagcagctctcatgagggacagcttcctgtcgcgccca
cctgacttaatgaggcctgctgctgcagcaatgccctcccttacttga

DBGET integrated database retrieval system