KEGG   Cyprinus carpio (common carp): 109104023
Entry
109104023         CDS       T05134                                 

Definition
(RefSeq) aryl hydrocarbon receptor-like
  KO
K09093  aryl hydrocarbon receptor
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109104023
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109104023
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 109104023
NCBI-ProteinID: XP_018972933
Position
30
AA seq 1021 aa
MSGGIGIYAVKKRKKPVQKIPKPPPPDGVKSNPSKRHRDRLNSELDKLTNLLPFSEDVRA
RLDKLSVLRLSVGYLKVKSFFNAKTKKTGGNGWLNERPGTFGGNGQSTTSLDGVSFSEGE
LLLQALNGFVLVVTAEGYVFYSSPTIQDYLGFHQSDVVHQSVFELIHTDDRAMFRRQLHF
ALNPTSCEGGEGSDAIQSSSDITRDLVNYNPQHIPPENSAFLERSFCCRFRCLLDNSSGF
LALNFQGRLKYLHGQNKLAEDGTLAHPQLALFVIATPLQPPSILEIRSKTLLFQTKHKLD
FTPMGIDTRGKVVLGYTEIELCMRGSGYQFIHAADMMYCADNHIRMIKTGESGITVFRLL
SKGGTWIWVQANARLVYKGGRPDFIIARQRPLTNEEGEEHLRQRKLQLPFNCATGEGVLY
ETEPTLDIADIQNQSKGQKMLKPPSLDPDSLLGCMLNQDHSVYNPNNEPDSQFTLDKAFR
DSHALLSVPGDTWQPSAPSTLAEVKEEGVVKDMMETLQQIIGDSSICGLQGFDVDDSVLK
EWENTLSRFHYNNDTELNEIITNDILSFVEDALFKENGVRLPEHLNSQGPFVEAPECLPE
MELQNNLAANQEFICQADMLDGSPGRGGFIGMNIQDGLNASSPGRGMVKLTHMGQQMLLG
DTFVQSFGLEQTTQKIPSNNNITFNPSLALQSQQLTQVGLGLQGAVQENGMIPCGQTNLQ
TGNQPHHNAMTVPLQSPLLQGTSAQPMGFHSQNPLSQQPSINQNPQWVSDNLLNSCTHNV
SGVQDAGLHSGPPTQLQGQFSLHTQNAANPGLPGWQQSQPTPQQVSKPFSSGQQNMTGFI
GEVTDLIAELLPHTNTQGFGSGFLPQTTSNSIYPQQGEIINNSPHQTTNSCMFTSTPQPS
VNGMHYGPAAPVSSMSSCQRVKGLITQSPTQASCYYQRCPSESIVGTSVIPQGDTNISPM
ACQVPLGLTADNVLAQQYLSCNSQTQVANHPLEEKGTFHFPSLANGNAYFSQNNQNSCCD
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtcggggggtatcggtatatatgcggtcaagaaacggaagaagcccgttcagaaaata
cccaagccaccaccacctgatggtgtgaaatccaacccatccaagcggcacagagaccgg
ttgaacagcgaattggacaagctgaccaaccttctacccttctcagaagatgtccgtgca
cggctggacaaactgtcagtgcttcgactcagcgttggatacctgaaggtcaagagcttc
ttcaatgccaaaaccaaaaagacaggaggaaatggatggctaaatgagcggccagggaca
tttggaggaaacggacagtcaacaaccagtctggatggagtcagtttctcagaaggggaa
ctgttgttgcaggccctcaatggctttgtgctggtggtcaccgctgaaggttatgtgttt
tattcatctccaactatacaggactacttgggcttccatcagtcagatgtggtccatcag
agtgtattcgagctcatccatacagatgatcgggcaatgttccgaaggcaactacacttc
gctctcaatcccacttcgtgcgagggtggcgaaggatctgatgcaattcaaagcagcagt
gacatcaccagagacttggtaaactacaaccctcaacacatccctccagaaaactcagcc
ttcttggaacgaagtttctgttgccgattccggtgcctccttgacaactcatcaggcttc
ctggccctgaacttccaggggaggctgaaatatctccatgggcaaaacaagttggcagaa
gatgggaccttggcccaccctcaactggctctttttgtcatagccacacccctccagcca
ccctctatcctggagatcaggagcaagactcttcttttccaaaccaaacacaagctggac
tttacacctatgggtattgacacaagaggaaaggtggttcttggctacactgagattgag
ctgtgtatgaggggctctggctatcagttcattcatgctgctgacatgatgtactgtgct
gacaaccatataagaatgataaagactggagagagtggtataacggtcttcagacttctc
tccaaaggaggtacatggatctgggtgcaggccaatgcaaggcttgtttataaaggagga
agaccagacttcattattgcccgacaaagaccactaactaatgaagagggtgaggagcac
ctccgtcaaagaaagttgcagctaccctttaactgcgccactggtgagggtgtcttgtat
gagactgaacccacactggacatcgctgacattcaaaatcagagcaaaggccagaagatg
ctcaaacctccatctctggacccagattctcttctcggttgcatgctgaatcaggatcat
tctgtctacaacccgaacaatgagcccgattcccagtttactcttgacaaggctttcagg
gatagccacgccctgctcagtgtccctggggacacctggcagccgtcagccccaagcact
ttggctgaggtaaaagaggaaggtgtggtaaaggacatgatggaaaccttgcaacagatt
attggggacagcagtatctgcggccttcagggatttgatgtggatgactctgtcctgaag
gagtgggagaacactctaagcaggttccactacaacaacgatacggaattaaacgaaatc
atcaccaatgacatcctctcttttgttgaggatgcactttttaaggaaaatggcgttcgg
ttgcccgaacacctcaatagccagggtccatttgttgaggcgcctgagtgtcttccagag
atggagttacagaataacttagctgctaaccaggaattcatctgccaggcagatatgctg
gatggatccccaggtcggggtgggttcattggaatgaacatccaagatggattgaatgcc
agtagccctggaagagggatggtgaagctcacccatatggggcaacagatgctacttggt
gacacttttgtccagtcattcggactggaacagacaacccagaagattcccagcaataat
aacattacgtttaatccttctcttgccctgcagagtcaacagctgacccaagtcgggctt
ggtctgcaaggtgccgtgcaagagaacggaatgattccgtgtggccagacaaacctacag
accggaaaccagccccatcacaacgcaatgactgtccctcttcaaagtcctctattgcag
ggcacttctgcccagccaatgggcttccacagccagaatcccctttctcaacaaccgtca
atcaatcagaaccctcagtgggtgtccgataacctgctgaactcttgcacccataacgtt
tcaggtgtacaagatgcaggactgcactctggcccacctacccaactacaaggacagttt
tctcttcacactcagaacgctgccaatcctggactgcctggctggcagcaatcccagcct
acccctcaacaggtctctaaaccgttttccagcgggcaacagaatatgacgggcttcatt
ggtgaagtgacagacttgattgcagaactgcttccgcacacaaacacacaaggatttggg
tctggtttcctgccccagacaacttcaaatagcatctatcctcagcaaggagagatcatc
aacaacagccctcatcagaccaccaacagctgcatgttcacaagcactcctcaaccctca
gtgaatgggatgcattatgggcctgcagctccggtatcttcaatgtcatcctgccagagg
gttaaaggtctgattacccagagtcctacacaagcatcctgctactaccagagatgtcct
agcgagtcaattgtgggcacgtcggttatcccacaaggggacacaaacatcagccccatg
gcctgtcaagttccgcttgggttaacggcagataatgtacttgctcagcagtatctctca
tgcaacagccagacacaggttgcaaaccatccacttgaggagaaaggaacattccatttt
ccctcgctggccaatggaaatgcctacttttcccagaacaaccaaaacagttgctgtgac
tattag

DBGET integrated database retrieval system