KEGG   Cyprinus carpio (common carp): 109104807Help
Entry
109104807         CDS       T05134                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04510  Focal adhesion
ccar04530  Tight junction
ccar04810  Regulation of actin cytoskeleton
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109104807
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109104807
   04530 Tight junction
    109104807
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109104807
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109104807
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109104807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109104807
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109104807
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109104807
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109104807
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109104807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH Pkinase_C Cortex-I_coil
Motif
Other DBs
NCBI-GeneID: 109104807
NCBI-ProteinID: XP_018973638
Position
3
AA seq 1310 aa AA seqDB search
MKAVDYEVVKVIGRGAFGEVQLVRHKDTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAF
ANSNWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDCIH
SMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDYISPEVLKSQG
GDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFPDDSDISKDAK
SLICAFLTDREVRLGRNGVDEIKRHSFFKNDQWAWENIRETAAPVVPELSSDVDTSNFDD
IEEDRGEEETFPIPKAFVGNQLPFVGFTYYQFHREAAIKTSDNHSSTKEDKSHLENLKKR
IYQLEEQLHSEMQLRDEMEQKCRASNTKLDKIMKELDEESNLRKSMETNMSLLEKDKIMI
QHRTTEHQRKAEQEAEKRRNLENEVSTLKEQLEDSRKMSQNNEKQLQKPKTPSRTTLSSQ
LREANDLLRAESDTVVRLRKSHTEMGKSMSQLESVNRELQEKSRAAENVKQQLEKELLQL
QTILDTERRTCSQGSEEIRELQARITGVQEDNKNLKHSLSKAELDRKQMQDRCNVLEKEK
NSLEIDLNYKLKTLQQRLDQELTEHRITKAQLTDKYESIEETKSAAMHTVEQKVAEENTL
RMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEEEVKELRVQLEQESGKRVLA
QNELKNWTMEAERLKGSEKQLKQEINAALENKRSVEFQLAQLTKQYRGNEGQMRELQDQL
EAEQYFSTLYKTQVKELKEEIEEKNRQTQEALRKVQDLYSEKESLSAQLDLTMTKAESEQ
LARALQEEQYFELSQEHKKAASRYKQEISEKDSTIAQLEESNKTLTKDVEILSKEKTELN
ERLRAQEEEFTAGKEELANTVKAHYEKALNIERTLKTQAVNKLAEIMNRKDMKLDQKKRG
STTDLRKKEKENRKLQLELNQEKEKFNHMAIKYQKEMNEMQAQLAEECTYRNELQMQLDS
KESDIEQLREKLNDLQLRVDSSSVTSLQPDEVDSNIAESRLEGWLAIPNRANIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAEADEIPRIFQILY
ANEGECRKEADMESVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACSKPLWHVFKPPPALE
CRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLALSQDEQKKWIGHLGKKIPKTP
PSTFARASPRTMSTRSVANQSFRKNPKNMPGKPSRAQSFLQAADTTSSTC
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtggactatgaagtggtaaaggtcataggacgaggtgcatttggagaagta
cagctggtgaggcacaaagacacacgcaaagtctacgccatgaagctgctcagcaagttt
gagatgatcaagaggtcggactctgctttcttctgggaagagagggatattatggccttt
gccaacagtaactgggtagtacagttgttttatgcattccaggacgaccgctacctctac
atggtgatggagtatatgccaggtggagacctggtcaacctgatgagcaactatgatgtg
cctgagaagtgggctcgtttctacactgctgaggttgtgctggcactggactgcatccac
tccatgggcttcattcacagggatgtaaagcctgacaacatgttgctagacaaggcaggc
cacttgaagctggcagactttgggacctgcatgaaaatgaacaaggatggaatggtacgt
tgtgacacagcagtaggaactcctgactatatttctcccgaggtactgaagtcgcaggga
ggagacggttactatggccgagagtgtgactggtggtctgtgggggtcttcctgtatgag
atgctcgtcggtgacacgccgttttatgctgactctctggtgggcacctacagcaagatc
atgaatcacaagaatgccttgaccttccccgatgacagcgacatctcaaaggatgcaaaa
agcctcatctgtgctttcctcaccgacagggaggtgcggttaggacgcaatggagtcgac
gaaatcaagcgacatagttttttcaagaatgaccagtgggcatgggagaacatcagagag
acggctgctccagtggtgccggagctaagcagtgacgtagacacaagcaactttgacgac
attgaggaggatcgaggggaggaggagacattccccattcctaaagcatttgtaggcaat
cagcttccgtttgtgggctttacctactaccagtttcatcgggaagcagctataaagaca
agtgacaaccacagctcgacaaaggaagataagagtcatttggagaatcttaagaagaga
atttatcagctagaagaacaacttcacagtgagatgcagctgagagatgagatggagcag
aagtgcagggcatccaatacaaagctagacaagataatgaaagagttagacgaggagagt
aacctaaggaagagtatggagaccaacatgtctttactggagaaagacaagatcatgatc
cagcaccgaacaacagaacatcagagaaaggcggaacaggaggctgaaaaacgaagaaat
ctggagaatgaggtgtctactttgaaggagcagctggaagactcgaggaaaatgagtcaa
aacaatgaaaagcagctgcagaaaccaaaaaccccatctcgcacaaccttgtcctcacag
ctgagggaagccaacgatcttctgcgggccgagtctgacacggtggtgcgtttgaggaag
agccacacagagatggggaagtccatgagccagctggagagcgtgaatcgcgagctgcag
gaaaagagccgtgccgcggagaacgtcaaacaacagctggaaaaagagctgctccagctg
cagaccatactagacacagagagacggacctgcagccagggctcagaggagatcagagaa
ctgcaagctcgtatcacgggtgtgcaggaggacaacaagaacttgaagcacagtctgtct
aaagcagagctggacaggaaacaaatgcaggacagatgtaatgttcttgagaaggagaag
aacagtctggaaatcgacctgaactacaagctgaagactctgcagcagcggctggatcag
gagttgacagagcatcgcatcacgaaggctcagctcacagacaaatatgagtctatcgaa
gagaccaagtcagctgctatgcacacggtggagcagaaggtggcggaggagaacacgctg
cggatgcgagcggagagcagggtggtggaggtggagaagcagtgctccatgctggagttc
gacctcaagcagtctgtacagaagatggagcagctgatgaagcagaaggagaggctggag
gaggaggtgaaggagctgcgggtgcagttggagcaggagtccgggaagcgtgtgctggcc
cagaacgagctgaagaactggacgatggaggccgagcggctgaaaggatcagagaagcag
ctcaaacaggaaatcaacgcggccctcgagaacaagcgctccgttgagttccagctggca
cagctcaccaagcagtaccgaggaaatgagggtcagatgagagaacttcaggaccagctg
gaggctgagcagtatttctcaacactctataaaactcaggtgaaggagctaaaggaggag
atagaggagaagaatcgacaaactcaagaggctctcagaaaagtccaagacctgtactcc
gagaaggagtcgctctctgctcagctggacctgaccatgacgaaggccgagtcggagcag
ttggcgcgcgcgctgcaggaggagcagtactttgaactctctcaggagcacaagaaagct
gcttcacggtacaaacaggagatctcagagaaggactcgaccatcgcacagcttgaagaa
tccaataaaacccttaccaaagatgtggagatcctcagcaaggagaagacagaactgaac
gagagactccgagctcaagaagaagagtttactgcagggaaggaggagctggcaaacaca
gtaaaggcccattacgagaaggccctgaatatagaaagaactctgaagacccaggcggtg
aataagctggctgagatcatgaaccgtaaggacatgaagttggaccagaagaagagaggc
agcaccactgacctgcgcaagaaagagaaggagaaccgcaagctgcagctggagctcaac
caggagaaggagaagttcaaccacatggccatcaagtaccagaaggagatgaacgagatg
caagcgcaattggcagaggagtgcacgtatcgcaatgagttgcagatgcagctagacagt
aaggagagtgacattgagcagctgagagagaaactgaacgacctgcagctccgcgtggac
agctccagcgtcaccagcctgcagccagacgaggtggacagtaacatcgctgaatcaagg
cttgaaggctggctcgcgataccgaatagagcaaatattaaaagatacggctggaaaaag
cagtatgttgtggtgagcagtaaaaaaatcctcttttacaatgatgagcaagacaaggag
cagtccaacccttctatggtactagacattgacaaacttttccatgtacgtcccgtcacg
caaggcgacgtttatcgagcggaggcagatgaaattccaagaatattccagatcctgtat
gctaatgaaggtgagtgcaggaaggaggcggacatggagagtgttcctcagggggacaag
accaactgtttgccccacaagggccatgagttcatccccactctctatcatttcccctcg
aactgcgaggcttgctccaaaccgctgtggcacgtcttcaagcctcctccggccctggag
tgccgccgatgccacgtcaagtgccacaaggaccatctggacaagaaggaggatgttatc
gccccttgcaaagtgaattatgatgtgacgtcagctagagacatgctgctcctggccttg
tcccaagatgagcagaagaaatggatcggtcatctcggcaagaagattcccaagacccct
ccttctaccttcgcaagagcatcccctcgcaccatgtccactcgctccgtagcaaaccag
tctttccgcaagaaccccaaaaacatgccgggcaagccaagcagggcgcagtcctttctc
caagcggcagacacaacatccagtacatgctga

DBGET integrated database retrieval system