KEGG   Cyprinus carpio (common carp): 109106385Help
Entry
109106385         CDS       T05134                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04260  Cardiac muscle contraction
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109106385
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109106385
   04261 Adrenergic signaling in cardiomyocytes
    109106385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109106385
Ion channels [BR:ccar04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109106385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 DUF716 DUF1673 DUF2721 DUF202
Motif
Other DBs
NCBI-GeneID: 109106385
NCBI-ProteinID: XP_018975295
Position
32
AA seq 141 aa AA seqDB search
MSTEYRRVSIIPAGTEKGRCVASEYFTEPEIEITTENTANILKMVRTATPFPMVSLLFVF
MAFIISNVGHIRPQRTILAFISGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFN
YRYGWSFAFAASSFLLKEVRG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgagtacagacgcgtttccataatcccagcaggtacagagaaaggtagatgt
gtggcctctgagtatttcacagagccagagatcgaaatcaccacagaaaacactgcaaat
atcctcaagatggtgcggacagctacgcccttccctatggtgtccctgctcttcgttttc
atggctttcatcatcagtaacgtgggccacatccgtccgcagcgcaccatcctggccttc
atttctggaatcttcttcatcctctcagggttgagtctggtggtggggttggtgctgtat
atctcaagtatcaatgatgaagtaatgaacaggccgcgggaaccagagcagttcttcaac
taccgctacggctggtcctttgcatttgctgccagctccttcctgctcaaagaggtcaga
ggatga

DBGET integrated database retrieval system