KEGG   Cyprinus carpio (common carp): 109108028Help
Entry
109108028         CDS       T05134                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00010  Glycolysis / Gluconeogenesis
ccar00562  Inositol phosphate metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109108028
   00562 Inositol phosphate metabolism
    109108028
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109108028
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109108028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 109108028
NCBI-ProteinID: XP_018976747
Position
34
AA seq 423 aa AA seqDB search
VTGRLCHLVASSHRYEDVNTYLIDDILAINNSLVTLPSSKCSEIHMTVIIRHGTRYPTTK
NIKKMRKFYDLVVRDAAVNWNYLSEIKSQWKMWYTDDMDGRLVDKGREDHRHLAQRLIKW
FPSLLTQENVRQRRVKLITSSKHRCVNSTIAFRKGLMEGLNIEDELEISVNDTLMRYFEQ
CKRFVKEVENNDTALEELQRFNDGPEMKRIVEKMADRLEVPYTNITDESVEAGFFLCAYE
FAIQNLNSPWCQLYDEVDAQVLEYAGDLKQYWKRSYGYEINSKSSCILFHDLFHRLDQVV
AQINSDDIVSEAVTVQVGHGETLLPLVTLLDLFKDDTHLSSTDFATQHNRIFKSGKIVPY
AANLLVVLYKCPEGIRMGVRMNEKSLTLPGLTDPVPMYEDVKKRYRALLEGCDQETVCKI
NNS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gttactgggcgtttatgtcatcttgtagcatccagtcatcgctatgaagatgtcaacacg
tacttaatcgacgacattttggccataaacaactccctcgtcacgctgccttcctcgaaa
tgcagcgaaattcatatgacagttattatccggcacgggacgaggtacccgaccactaaa
aacattaagaagatgcgcaagttttatgatctcgtcgtgcgtgatgcggctgtcaactgg
aactatttgtcagagataaagtcgcagtggaagatgtggtacacggatgatatggacggg
cgactggtggacaagggccgtgaggatcacaggcacctggcgcagagactcatcaaatgg
ttcccttctttgctgacccaggaaaatgtgcgtcaaagacgcgtgaaactgatcaccagc
tccaagcacaggtgtgtgaacagtaccatcgctttcagaaagggactaatggaaggactc
aacatagaagatgagttagaaatttctgtgaacgacactttgatgcgttactttgaacag
tgcaaacggtttgtgaaagaagtggagaacaacgataccgccttggaggaattacaacgt
tttaatgatggccctgagatgaaaagaatagtggagaaaatggctgacaggctggaggtc
ccttacaccaacatcaccgatgaatcagtggaagcaggtttcttcctgtgtgcatatgag
tttgctatccagaacctgaactcaccctggtgccagttgtatgacgaagtagatgcacag
gtgctggagtatgctggtgacctgaaacagtactggaagcgaagctatgggtatgaaatc
aacagcaagtcaagctgcatcctcttccatgatcttttccatcgtcttgaccaagttgta
gcccagatcaactcagatgatattgtatcggaggctgtgacagtgcaggtcggccatggt
gagacgctgttaccccttgtcaccctgctggatctgttcaaggatgacacccacctcagc
tcaactgactttgcaacccagcacaacagaatatttaaaagtgggaagattgtgccatac
gctgccaacctgctggtagtgctgtataaatgcccagaggggattaggatgggtgtgcga
atgaatgagaaatctttgaccttgcctggactcactgaccccgtcccaatgtatgaggat
gtgaagaaacgctaccgtgctctgctagagggttgtgaccaagagacagtgtgtaaaatt
aacaattcatga

DBGET integrated database retrieval system