KEGG   Cyprinus carpio (common carp): 109108225Help
Entry
109108225         CDS       T05134                                 

Definition
(RefSeq) maleylacetoacetate isomerase-like isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00350  Tyrosine metabolism
ccar01100  Metabolic pathways
Module
ccar_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109108225
Enzymes [BR:ccar01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     109108225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 109108225
NCBI-ProteinID: XP_018976950
Position
34
AA seq 220 aa AA seqDB search
MSASAARLIKPVLYGYFRSSCSWRVRIAFALKGIEYEQKPVNLIKDGGQQLTDQFKAINP
MQQVPAVTIDGITLSQSLAIIQYIEETRPEPRLLPADPKQRGQVRIICDIIASGIQPLQN
LYVLQKIGAEKVQWAQHFINQGFEALEPILKQTAGKYCVGDEISMADICLVPQVYNAERF
KVDMSQFPTIRRLNQTLTEIDAFKISHPSCQPDTPDDLQA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcagctgcacgtttaatcaagcctgttctttacggatattttagaagttca
tgctcttggagagtccggatagcgtttgcattgaaagggattgaatatgagcaaaagcca
gtaaatctcatcaaggatggtgggcagcagctaacagatcaatttaaggcaataaaccca
atgcagcaagtgcctgcagtcaccattgatggcatcaccttgtctcagtcgttggccatc
atccagtacattgaggaaactcgtccagagccccgcctcctgcctgcagacccaaagcag
agggggcaggtccgcatcatctgtgacatcatcgcgtctgggatccagcccctccagaac
ctgtatgtgcttcagaaaattggagcagagaaggtacagtgggctcagcatttcatcaac
caaggattcgaggccttagagcctattctgaagcagacggcagggaaatactgtgttggc
gatgagatatccatggcagatatttgtcttgtgcctcaagtctacaacgctgaaaggttc
aaggtggatatgtcccagttccctactatcagaaggttaaaccagaccttaactgagatt
gatgctttcaaaatcagtcatccatcatgtcagcctgatactcctgatgatttgcaggca
taa

DBGET integrated database retrieval system