KEGG   Cyprinus carpio (common carp): 109108409Help
Entry
109108409         CDS       T05134                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00970  Aminoacyl-tRNA biosynthesis
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109108409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccar03029]
    109108409
Enzymes [BR:ccar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     109108409
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     109108409
Mitochondrial biogenesis [BR:ccar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109108409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 109108409
NCBI-ProteinID: XP_018977111
Position
34
AA seq 385 aa AA seqDB search
MKKEAQKIQMRDTWFLYIYLLKLQNTLFKNVFKKSNVPCLLQVSQALRDGRVSATELCRK
CIDQIQRTHYLNAFITITGETAMEQAQRADNRIRTGLRHAWKRSNHHEWLLELQPTFENR
RLSCLPEPCSPKNGLATRMDYANVCMSFLRAGSTDGVFGPVRNPWSYTTLYREQSTEDPD
SDWAISGGSSGGSAAAVAALSNMSHGHRSTIDSSTDAMYATTRHEGFNNVVRRRILSGNY
FLLKSNYERYFVKAQQMRRLITEDLKNVFRSGIDVLLTPTTLSDAARYTDFIQEDNRTRS
AQEDVFTQPVNMAGLPAVTVPTALSRRGLPISLQLIGQTLQDWKLLTVAHWMEQQVNFPM
IHLHGDSDERKLDRSVRERTHTIGS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaagcgcagaagatccaaatgcgagacacgtggtttttatatatctaccta
ctaaaattacaaaacactctgtttaaaaatgtttttaaaaaatcaaatgtcccttgctta
ctacaggtgtcccaggcactgagggatgggagggtgtccgccactgagctctgcagaaaa
tgcatcgaccaaatacaaagaacacattacctgaatgcatttatcaccattacaggggag
acagctatggagcaagcacagagagcagacaacaggatccgcacaggtttgcgtcacgcc
tggaaaaggtcaaatcatcacgagtggctcctggagcttcagcccacctttgagaacagg
agattgagctgtttgcccgagccgtgctcccctaaaaatggcctagcaacgcgcatggat
tatgctaatgtctgcatgtctttcttaagagctggaagtacagatggggtgtttggtccc
gttcgtaacccatggagctacacaaccctataccgtgagcagagcacagaagatccagat
tctgactgggcaatctcaggaggaagttcaggaggtagtgctgcagcagtggcagctctc
agcaacatgtcacatggccatcgtagtaccatcgacagctccacagatgccatgtatgcc
accacacgacatgaaggcttcaacaatgtggttcgcagaagaattctctctggaaactac
ttcctactgaaatcaaactatgagcgttactttgtgaaggctcaacagatgcggcgtctt
atcactgaagatttaaaaaatgtgttccgctctggcattgacgttctcctgacacccaca
acgctgagcgatgcggcgcgctacactgacttcatacaggaagacaaccgaacacgcagt
gctcaggaggatgtcttcacccagcctgtcaacatggcaggtttgcctgctgtcacggta
ccaacagcactctcacgccgaggtcttcccatcagcctgcagctgattggtcagacacta
caggactggaagctgttgacagtagcccactggatggaacaacaagtcaactttccaatg
atccatttgcatggagactcagatgagagaaagctggaccgatcggtcagagaaaggaca
cacacaataggatcataa

DBGET integrated database retrieval system