KEGG   Cyprinus carpio (common carp): 109108724
Entry
109108724         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor nuclear translocator-like protein 2
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109108724
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109108724
SSDB
Motif
Pfam: PAS_11 HLH PAS_3 PAS PAS_9
Other DBs
NCBI-GeneID: 109108724
NCBI-ProteinID: XP_018977374
Position
35
AA seq 688 aa
MMVGGDCALSSSSAFPRISTTVLIPSRPLLACFYARPTLPIDIGVLGPGVPAPAMSARNT
AAGGGDGATGEKPGDALEGEPQGLSVSLSGLMTPTSATGMASGMELPRKRKGSMDNPETK
SASNLEEDMEDDQGRSEGDDQHLKIKCVREPHSQIEKRRRDKMNNLIDELAAMIPTCNPM
SRKLDKLTVLRMAVQHLKSLKGATSSFAEANYKPAFLPDDELKHLVLRAVDGFLFVVGCD
RGKIVFVSESVSKILNYGRTELIGQSLFDYVHPKDIGKVKEQLSASELYPRERLIDAKTG
LQVQAELPVGAARLCSGARRSFFCRMKYNKVTVKEEKDFQAGAYEKRRSSQRYCTVHCTG
YMRTWPTRQLGTEGEAETDKESSHFSCLVAVGRVHPHTLPQANGEIKVKPTEFVTRYAMD
GKFTFVDQRXIDSCFGNKXMQIFVTGCYEYFHLDDLPHLADRHRKVLRSKEKIETNCYKF
KTKYGSFVTLQSQWFSFINPWTKEVEYIVSTNTVISNPGGSGDKSEQPSSSKASEDDAKK
SQQVPIIPGISSASGMIYAGCIGTQIANEIMDYNRMNSSPSSGNTSPFSVLQDKSPLALA
QASSNVPNGEATDVEMPGKSSSEVEARGGAFTAGESLMEGSSQLDLEGVPGLGALSTDEA
AMAVIMSLLETDANLGEAVDFDEMHWSL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgatggtaggaggagattgtgcgttgtcgtcgtcttccgcgtttccccggatttcaacc
actgttctgattccatcgcgtcctctccttgcatgtttttacgctcggcccaccctccca
attgacatcggagtcctgggccccggcgtaccggctccagccatgtcggcgaggaataca
gcggctggcggcggtgacggagcgacgggggaaaagccaggagatgcattagagggagaa
ccccagggcctctctgtctctctgtctggtttgatgacccccacctcagccaccggcatg
gcctcaggcatggagctgcccaggaaacggaaaggcagcatggacaacccggaaacaaaa
tctgcatcaaatctagaggaggatatggaggacgatcagggaagatcggaaggagacgac
cagcacttaaaaattaagtgtgtcagagaacctcacagtcagatcgagaaacgccggcga
gataagatgaataatctgattgacgagttggcagcgatgattcccacctgtaaccccatg
tcccgcaagcttgacaaactcactgtgttacgaatggctgtccagcacctcaaatcactc
aaaggagcaaccagctcgtttgcagaagccaattacaaacctgcattcctcccagatgat
gagctcaaacaccttgtcctaagggctgtggatggatttctctttgtggttggctgtgac
cgtgggaagatagtctttgtctcagaatcggtttcaaaaatcctgaattacggtcggacg
gagttaattggacagagcctgtttgattatgttcatcctaaggacattggtaaagtgaag
gaacagctgtctgcctctgaactctacccgcgggagcgcctcatagacgccaaaacggga
ttgcaggtgcaggctgagctccccgtcggagcggctcggctttgctctggagcccggcgc
tcattcttctgccgaatgaagtacaacaaagttactgtcaaagaagagaaggacttccag
gctggggcttacgaaaaaagaaggtcatcacagcggtactgcactgtgcactgcacgggg
tacatgcgcacctggcccacgcgccagctgggcacggagggggaggctgagacggataaa
gagagctcccacttcagctgcctggtagcagtgggccgcgtgcacccccacaccctccca
caggccaacggagagatcaaggtcaagcctactgaatttgtcacccgctacgccatggat
ggcaaattcacctttgtggatcaacggtaaattgactcttgttttgggaataaatgaatg
caaatttttgtgactggatgctatgaatacttccatctggacgacctgcctcatttggca
gatagacaccgaaaagtgctgaggagtaaagagaagattgagacaaactgctataagttt
aaaacgaaatatggctcttttgtcaccttacaaagtcagtggtttagttttataaatccc
tggaccaaagaagtagaatacatagtgtcgaccaacaccgttatatctaatccaggtgga
tcaggggataaatctgagcagcctagcagttccaaggcctcggaggatgatgccaagaag
tcccaacaagttccaatcatcccagggatctccagtgcatcaggcatgatttacgctggg
tgcatagggacccaaattgctaatgagataatggactataataggatgaactcctcacca
tccagcggcaatacaagtccattcagtgtactgcaggacaagtctccactggcccttgca
caggccagcagcaatgtgccaaatggggaagcaacagatgtggagatgcctggcaaatca
agctcagaggtggaagcgaggggtggggccttcacagcgggagaaagtctcatggagggg
agctctcagttggatctggagggggttcctgggttaggcgctctgagcactgacgaggca
gccatggcggtcattatgagtttactggagaccgatgccaacctgggtgaggccgtggac
tttgacgagatgcactggtctctgtga

DBGET integrated database retrieval system