KEGG   Cyprinus carpio (common carp): 109109041
Entry
109109041         CDS       T05134                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00230  Purine metabolism
ccar00240  Pyrimidine metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109109041
   00240 Pyrimidine metabolism
    109109041
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109109041
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 109109041
NCBI-ProteinID: XP_018977700
Position
35
AA seq 264 aa
MATPPKRFCSSLDVDLSFEKRALKISIEGNIAAGKSTFVRLLERASEEWEVIPEPIGKWC
NVQTTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRAQLQPPSAKLQQA
EQPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLR
ADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNRTTKLDFKYLKDLPILVLDVN
EDFKNDRIKQEGITDKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctactcctccgaagagattttgttcaagcctcgacgttgacctcagtttcgaaaaa
agggcattgaagatctcaatagagggaaacattgcggcagggaagtcaacttttgtgcga
ttgttggagcgagcgtcggaggagtgggaggtcataccagagcccattgggaagtggtgc
aatgtacaaaccacagagaatgagtatgaggagctcagcacttcccagaagagtggaggc
aacctgctgcagatgttatatgacaagcccagtcgctggtcttacactttccagacctac
gcctgcctgagtcgcgtccgtgcacagctccagcctccttctgccaaacttcagcaggca
gagcaaccagtccagttctttgagcgctctgtctacagtgatcgatatgtgtttgcctct
aacctctttgaatctggagatctgaatgagactgagtgggccatctatcaagactggcat
tcatggctcctcactcagtttgagtcccagattgagcttgatgccatgatctatctccgt
gctgatcccgagaggtgtatgcagcgtcttcagttcagaggacgagaggaggaacaagga
attcccttggactacctggagaagcttcattataagcatgagtgttggctgtacaaccga
accacaaagttggattttaagtatcttaaagaccttccaatactggtcttggatgttaat
gaggattttaaaaatgacagaattaagcaagaaggtattactgataaggtaaaggagttt
ttgagcaccctgtag

DBGET integrated database retrieval system