KEGG   Cyprinus carpio (common carp): 109109306Help
Entry
109109306         CDS       T05134                                 

Definition
(RefSeq) flavin reductase (NADPH)-like
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00740  Riboflavin metabolism
ccar00860  Porphyrin and chlorophyll metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    109109306
   00860 Porphyrin and chlorophyll metabolism
    109109306
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     109109306
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     109109306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 Epimerase NmrA 3Beta_HSD DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 109109306
NCBI-ProteinID: XP_018977991
Position
35
AA seq 207 aa AA seqDB search
MSDAIKNVAIFGSTGMTGLATLPIAVAAGYNVTVLVRDAARLPPDHKASRVVVGDVLNKD
DVKKTLEGQDAVIIILGTRSDLSPTTMMSEGTRNILEVMKARGIRKVIACMSAFLLWDRA
KVPPRLVPVTEDHDRMYTVLKESGLDYVAVMPPHIAGDKPLTEKYTVTENMLKGRVISKY
DLGHFFVKCLSISEWDGKTVGVCGEYS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgctataaaaaatgtggcaatattcggcagcacggggatgacggggttagcg
accttacctatcgcagtggccgcaggttacaatgtgactgtgctggtgagagacgctgca
aggcttcctccagaccacaaggcctccagagtagtggtgggagacgttctgaacaaagat
gatgtgaagaagaccctggagggtcaagatgcggtgatcatcattctggggacaagaagt
gatctcagtcccacaacaatgatgtctgagggaacccggaacattctggaggttatgaaa
gcccgcggaatccgcaaagttattgcgtgcatgtcagcgttcctcctgtgggatcgtgcc
aaagttcctcctcgcctggtgccggtcactgaagatcatgaccgaatgtacaccgtcctg
aaggagtcaggattggactatgtagctgtcatgcctccgcatattgctggtgacaaacct
ctgacagaaaaatacactgtgaccgagaacatgttaaaaggaagagtcatctccaaatat
gacctgggccatttctttgtcaagtgcctttccatatctgaatgggatggaaagacggtt
ggagtctgtggagaatatagttaa

DBGET integrated database retrieval system