KEGG   Cyprinus carpio (common carp): 109109371Help
Entry
109109371         CDS       T05134                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109109371
Membrane trafficking [BR:ccar04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109109371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109109371
NCBI-ProteinID: XP_018978042
Position
35
AA seq 345 aa AA seqDB search
MASLPASERRAFALKINRHSSADIRRHFSGVSHGSLPHHRNSYSASGSICFNIPQSYEAV
EPVDLDEFLMSQLRSGDAELMQELGEFPDDDLELELVERECRTLRPSVPEEGVELDPHVR
DCVQSYTQPWLVVSRRSQGYGWIAYSERTDANRVLQRQTFESDVEPDKQEQVEKSPSLPA
LCDDTTRTTLTCSDFNLRALQPDRRVESLLRFSSPEELDRFNQEARNSNRYGELFGLYPP
IDEEDAVAIRPIPDCPKEHFGQRILVRCQTIKFEIDIEPFFATMALYDLKEKKKISENFH
LDMNSDQMKGFLRAHTPNTDASTLARSAVFSISYPSPDIYLVVKF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgccagcgtcagagcggagagcattcgctctcaaaatcaacagacactcc
tcggcagatatccggagacacttcagtggggtcagccatggttccctgcctcaccaccgg
aacagttacagcgcctctggctctatctgcttcaacatacctcagtcatatgaagcagtt
gagccggtggacctggatgagttcctgatgtcacagctgcgcagtggagatgccgagctc
atgcaggagctgggggagtttccagatgatgacctggagttggagctggtggagagggaa
tgcaggaccctccgcccctctgtccccgaggaaggagtggagctggatcctcatgtgagg
gattgtgttcagagttacactcagccctggctggtggttagcagaagatctcagggttat
ggatggattgcgtactccgagaggacagatgctaacagagtcttacagagacagacgttt
gagtctgacgttgagcctgacaaacaagagcaagtagaaaagtcgccgtccctgccagca
ctttgtgatgatacaactcggaccaccctcacatgctcagactttaacttacgggccctg
cagccggaccgtcgtgtggagagcctcttgcgcttcagcagtccggaggagctggatcgt
ttcaaccaggaggccagaaatagcaatcgctacggcgagctcttcggcctctacccacct
attgatgaggaggatgcagtagcgattcggcccattcctgactgtcccaaggagcacttt
gggcagaggatactagtgcgatgccagaccatcaaatttgagattgacattgagcccttc
tttgcaaccatggccctctatgacctgaaagagaagaagaagatttcagagaacttccat
cttgacatgaactcagatcagatgaagggtttcctgcgcgctcacactcccaacactgac
gcctccactttggccagatctgcagttttctcaatctcctacccttctccagatatatat
ctggtcgttaagttttaa

DBGET integrated database retrieval system