KEGG   Cyprinus carpio (common carp): 109111140Help
Entry
109111140         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109111140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109111140
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109111140
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: STE group
  STE20 family
   109111140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH
Motif
Other DBs
NCBI-GeneID: 109111140
NCBI-ProteinID: XP_018979650
Position
37
AA seq 429 aa AA seqDB search
MTHEKMRPSEKKRLPASFNVLIEKLKRITLNCSTLFFVIFQTQSASNTLQKHKSSSSFTP
FIDPRLLQISPSSGSSLNNMGFSNEGRLQDPSRKGSVVNVNPVNTRPQSDTPEIRKYKKR
FNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNILVTISG
KKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGELEGCVHYKVVKYERIKFLVIALKNL
VEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAV
YDIYLPTHIQMNIQTHAIIILPNTEGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTS
VAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQQLKFLCERNDKVRHPHREKKLLW
HTLRNQAKN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgagaaaatgagaccaagtgagaaaaagaggctgccagccagtttcaacgtg
ttaattgagaagctcaaacgcattaccttaaattgttctaccctgttttttgtcatattt
cagacacaatctgccagcaacacacttcaaaaacacaagtcttcttcctcttttacccca
tttattgacccacgtcttctacagatttccccttccagtggcagttccctcaacaacatg
ggctttagtaatgagggacgtctgcaggacccatcccgtaagggctctgtggtgaatgta
aacccagtaaacactcggccacagagtgacacaccagaaatccgcaagtacaaaaagagg
ttcaactctgagattctgtgtgctgcactttggggagtaaatctgttggtaggaactgaa
agtggcctcatgcttcttgatcgtagtgggcaggggaaagtttatccacttattaacaga
cgccgttttcaacaaatggatgttcttgaaggccttaatattctagtgacaatatcagga
aagaagaacaaactgcgagtttattatctgtcatggctgaggaacaagattctgcataat
gaccctgaggtggaaaagaaacagggttggactacagtgggggagctggagggatgtgtg
cactacaaagtcgttaaatatgaaagaatcaagttcttggttattgccttgaaaaattta
gtggaagtgtatgcttgggcaccaaagccgtaccacaagtttatggcctttaagtcattt
ggagacctggtccacaagcctctcttagttgatctgactgtggaagagggtcaaagatta
aaggtcatctatggctcctgctctggttttcatgctgtagatgtggattcaggggcagtt
tatgacatctaccttcccacacatattcaaatgaatatccagacccacgccatcatcatc
ctcccaaacacagaaggcattgagctgttggtgtgctatgaggatgaaggcgtgtatgta
aacacttatggaaggatcaccaaagacgtggtgctgcagtggggtgagatgcccacttct
gttgcttacatcagatcaaaccagatcatgggctggggggagaaagctattgagattcgt
tctgtggagactggtcacctggatggtgtgttcatgcacaagagggcacaacagttgaag
tttctctgtgaaagaaatgacaaggttagacatccacacagggaaaaaaaattattatgg
cataccttacggaaccaagcaaaaaactaa

DBGET integrated database retrieval system