KEGG   Cyprinus carpio (common carp): 109112915Help
Entry
109112915         CDS       T05134                                 

Definition
(RefSeq) glutamate-rich WD repeat-containing protein 1-like
  KO
K14848  ribosome assembly protein RRB1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccar03009]
    109112915
Ribosome biogenesis [BR:ccar03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    109112915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Voldacs FAM176 Vpu CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 109112915
NCBI-ProteinID: XP_018981345
Position
39
AA seq 162 aa AA seqDB search
MTERGARLIVMRIHNLHETGKDKNESSDEESDEDEEDEEKKPQLELAMMPHYGGIIRVRV
RPAGWMMRGRERTELELAMMPHYGGINRVRVTQRGEQTFAALWSEKGQVEIFDLRPQLEA
VHSSAAMSAFIKQQKEATPLFSFSGHMSEGFAIDWSPKVPGV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacggagagaggagccaggcttattgtcatgcgcatacacaatcttcatgaaactggc
aaagataaaaatgaaagcagtgatgaagaaagtgatgaagatgaggaggacgaggagaag
aaaccacagttggagctggccatgatgccacattatggtgggatcatcagagtccgagtt
cgcccagcagggtggatgatgagaggacgagagagaacagagttggagctggccatgatg
ccacattatggtgggatcaacagagtccgagtgacccagcgaggtgaacagacatttgct
gcgctctggtcagagaaaggacaggtggagatttttgacctccgacctcagcttgaggcg
gtgcacagttcggcagcgatgtcggccttcatcaagcagcagaaggaagccacgcctctt
ttcagtttttctggtcacatgtcagaaggatttgccattgattggtcacccaaggttcca
ggtgtgtaa

DBGET integrated database retrieval system