KEGG   Cyprinus carpio (common carp): 109113486Help
Entry
109113486         CDS       T05134                                 

Definition
(RefSeq) septin-7-like
Organism
ccar  Cyprinus carpio (common carp)
SSDB OrthologParalogGFIT
Motif
Pfam: M
Motif
Other DBs
NCBI-GeneID: 109113486
NCBI-ProteinID: XP_018981832
Position
40
AA seq 86 aa AA seqDB search
MEEERREHVMKMKKMETEMEQVFEMKVKEKKQDSEAELERRHEQMKKNLEAQYKELEEKR
RQFEEEKANWETQQHILEQQKLDASK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagaggagggagcacgtgatgaagatgaagaagatggagacagagatggag
caggtctttgagatgaaggtcaaagaaaagaagcaagactctgaggcagagttggagcgg
cgtcacgaacagatgaagaagaatctagaagctcagtataaagagcttgaggagaagagg
cgccagtttgaggaggaaaaagccaactgggagacccagcaacacatcctggagcagcag
aaacttgatgcatcaaagtga

DBGET integrated database retrieval system