KEGG   Cyprinus carpio (common carp): 109113653
Entry
109113653         CDS       T05134                                 

Definition
(RefSeq) single-minded homolog 1-like isoform X1
  KO
K09100  single-minded
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109113653
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109113653
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS SIM_C HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 109113653
NCBI-ProteinID: XP_018982015
Position
40
AA seq 550 aa
MKEKSKTAARTRREKENSEFYALARMLPLPSAITSQLDKASIIRLTSSYLKMRLVLPQGL
GEVWGRSRSLENTNLELGSHLLQVIISKMLQTLDGFIFVVAADGKIMYISETASVHLGLS
QVELTGNSIYEYVHPADHDEMTAVLTPPPSYHSQLIHEHEVERSFFLRMKCVLAKRNAGL
TSGGYKVIHCSGYLKTSVLDCYQNVGLVAVGHTLPPSAVTEIKLHSNMFMFRASLDMKLI
FLDSRVSELTGYEPQDLIEKTLYHHVHSCDSFHLRCAHHLLLVKGQVTTKYYRFLSKHGG
WVWVQSYATIVHNVRSSRPHCIVSVNYVLTDTEYKGLALSLEQLKPSKPAFPYANQTPAK
ILTSPYSQQFSFFQPERSDSDRDSQWDGSPLTDSASPQRLDTCVQTHSHTHASHTQREGW
WDASQHNHQAHAAHWDDERVDGSPGSSGDSGDSCHEIRAFPPRESQSRMGARQEPIKVED
GCMSDVFSSVCRGPPRLVLHRDDRDQSPASLSGLSSPGSDRLSHYDVNTHMHFQTSAAHN
GTSVIITNGS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgaaggagaagtccaagacggcggcgaggacgcggcgcgagaaggagaacagcgagttt
tacgcgctcgccagaatgttgccgttaccgtcggccatcacgtctcagctggacaaagcg
tccatcatccgactgaccagcagctacctgaagatgcgactggtgctccctcaaggtttg
ggggaggtttggggtcgaagcagatctttagaaaacacaaaccttgagctcggatctcat
ttactgcaggtaataatcagcaagatgctccagacgttagacggctttatattcgtggtg
gctgcggatgggaagatcatgtacatctcagagacggcgtcggttcatctgggcctttca
caggtagaactgaccgggaacagtatttatgagtacgtccatccggccgatcacgacgag
atgaccgcggttctgacccctccaccctcgtatcactcgcagctcatccacgagcatgaa
gtggagcgctcgttcttcttgagaatgaagtgtgttttggccaaacgtaacgccgggctg
acgagcggaggatataaggtcatccactgcagcggctatctgaagacgtctgtgctggac
tgctatcagaacgtgggtctggtggcggtgggtcacactttacctcccagcgccgtcacc
gagatcaagcttcacagcaacatgttcatgttcagagccagtctagacatgaagctcatc
ttcctcgactccagggtttcagagctgacaggatatgagccacaggacctgattgagaag
accctgtatcatcacgtgcacagctgtgacagctttcacctgcgctgcgctcatcacctc
ctgctggtcaaaggtcaggtgaccactaaatattaccgcttcctgtccaaacacggcggc
tgggtttgggtgcagagttacgccacgatcgttcacaatgttcgctcgtctcgtccacac
tgcatcgtcagcgtcaactacgtcctcacggacacggagtataaaggcctggcgctgtct
ctggagcagctgaagcccagcaaacctgcgttcccttacgcaaaccagaccccagccaag
atcctgacttctccgtactctcagcagttttcgttcttccagcccgagcgctcagattcc
gaccgcgacagccaatgggacggcagccctctgacagactccgcctccccgcagcgactg
gacacgtgtgttcaaacacactcacacactcacgcctcacacacacagagagagggatgg
tgggatgcgtcacaacacaaccatcaagctcacgcagctcattgggacgacgagcgcgtg
gacggatctccaggctcctcgggtgattcgggagacagttgccatgaaatccgggctttt
cccccgagggagtcccagagccggatgggtgccagacaggagccgattaaagtggaggac
ggctgcatgagtgatgtcttctcctccgtctgcagaggaccgccccgtctcgtcctgcac
cgagacgacagagaccagagtccagcctcgctgtccggtctgagcagtcccggctcggac
agactgtcccattatgacgtgaacacacacatgcactttcagaccagcgccgcgcacaac
ggcacatcggtcatcatcaccaacggcagctga

DBGET integrated database retrieval system