KEGG   Cyprinus carpio (common carp): 109113842Help
Entry
109113842         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04060  Cytokine-cytokine receptor interaction
ccar04068  FoxO signaling pathway
ccar04210  Apoptosis
ccar04217  Necroptosis
ccar05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109113842
   04068 FoxO signaling pathway
    109113842
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109113842
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109113842
   04217 Necroptosis
    109113842
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109113842
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109113842
   04052 Cytokines and growth factors [BR:ccar04052]
    109113842
   04090 CD molecules [BR:ccar04090]
    109113842
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109113842
Cytokines and growth factors [BR:ccar04052]
 Cytokines
  Tumor necrosis fators
   109113842
CD molecules [BR:ccar04090]
 Proteins
  109113842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 109113842
NCBI-ProteinID: XP_018982192
Position
40
AA seq 317 aa AA seqDB search
MWQLLFFSDMNGNLSHSPQPVFMVDSGGGHPKQHRYYHQQLPRPPVPRPPVPRPPVPCWT
FPPARAEMKNRGWGRMNGGIAWVLTLILLLVFAALGLGAYQIYIYIHTHIQGEEIPTQMQ
SPAPQKQIGLNPAELNKNKQNSAAHLIGRADQSTSSGILKWEANLGDAFTEGVKYINGGL
QVNKTGLYFVYSRVEFLSPKCNPRDSYTHLMSRQRTGHNRIIMEDHQEGFCTAGSKHPWM
TGSHLGSLQHLKQSDWLFVNVSHPHLISKINHSNYFGPLQDQLIIEDYYVMHMKGMIVIS
DEEVGNLWTTLRSSELH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctcctgttctttagtgacatgaacggtaacttgagccactcaccccagcca
gtgttcatggtggattctggcggaggtcaccctaaacaacatcgatattaccaccagcag
ttgcccagaccaccggtgcccagaccaccggtgcccagaccaccggtgccctgctggacc
ttcccccctgcccgagctgagatgaagaacaggggctgggggagaatgaatggtgggata
gcctgggtactgacactgatactcctgctggtttttgcagccctgggactgggtgcctat
cagatatatatatatatacacacacacatacaaggggaagaaatacccacacaaatgcag
agccccgcgccacagaaacaaattggcctgaatcctgctgagctgaacaagaacaaacaa
aactctgcagcacacttaataggtcgtgccgaccagagcacatcatctggaattctgaag
tgggaagcaaatctcggtgatgccttcacagaaggtgttaagtacatcaacggcggcctt
caggtcaacaagaccggtttgtactttgtttactcccgcgtggagtttctttcacccaag
tgcaaccccagagactcttacactcacttaatgagtcggcagagaactggtcacaaccgg
ataatcatggaagatcaccaagagggcttttgtacagcggggagcaaacatccgtggatg
accggcagtcatttaggctcgcttcagcatctcaagcagtctgactggctgtttgtcaat
gtctcacacccccatctgatcagcaaaattaatcacagcaactattttggtcctcttcaa
gatcaactaatcatagaggactattatgtgatgcatatgaagggcatgattgtgatttca
gatgaagaggtcggcaatctctggactaccctgagatcctcagagcttcactag

DBGET integrated database retrieval system