KEGG   Cynara cardunculus var. scolymus (artichoke): 112503246Help
Entry
112503246         CDS       T05604                                 

Definition
(RefSeq) uncharacterized protein LOC112503246
  KO
K17434  large subunit ribosomal protein L53
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccav03011]
    112503246
Ribosome [BR:ccav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    112503246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 112503246
NCBI-ProteinID: XP_024963075
Position
Unknown
AA seq 128 aa AA seqDB search
MLKFLSKVKIEFNALDTRTAACMEFLAQCNARTAKESNPSCQLLVKRRTDSHPPQISVTF
VNGVEEVFDATSTPAQTIRKMILEKGLQLETEQMFREAGEKWPVIIPEEELHQSFPGTKP
RKAEEKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcttgtccaaagtgaagatcgaattcaatgccctagatacacgcacggcg
gcgtgtatggaattcttggctcagtgcaatgctcgaacggccaaggaatccaatccttcc
tgccagttgttggtcaagcgccggactgacagccacccaccgcagatctccgtcacattc
gtaaatggagtggaggaggtttttgatgccacctccacacctgcacagaccatccggaag
atgattctggaaaaaggtctgcagctcgagacggagcaaatgtttcgtgaagctggcgag
aagtggcccgttattattccagaggaagagctccatcaatcgttccctggtactaagcca
aggaaagctgaagaaaagaagcaatag

DBGET integrated database retrieval system