KEGG   Cynara cardunculus var. scolymus (artichoke): 112503571Help
Entry
112503571         CDS       T05604                                 

Definition
(RefSeq) arogenate dehydratase/prephenate dehydratase 1, chloroplastic-like
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    112503571
Enzymes [BR:ccav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     112503571
    4.2.1.91  arogenate dehydratase
     112503571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 112503571
NCBI-ProteinID: XP_024963353
Position
Unknown
AA seq 407 aa AA seqDB search
MALKAVPIWVCVNHSLSQLGLFDFVQNKKKTPAFTNCRVNLSKFRKWECLGLKLAEPERA
QTHVEDDKPLSPSDLGSTSTDERIQDTQITESKGFHKDLNSLPKPLSATDLVSSGNDGSK
VRVAYQGLPGAYSEAAALKAYPKCETVPCDQFESVFKAVELWLVDKAVLPIENSVGGSIH
RNYDLLLRHRLHIVGEVQMVVNHCLLGVPGVKKEELKRVLSHPQALDQCEIALNKLGVVR
VSAEDSAGAAQIVASEGIRDTGAVASSRAAEIYGLDILAQTIQDDLDNVTRFLILAREPI
IPGPDKPYKTSIVFTLEEGPGVLFKALAVFALREINLSKIESRPQRKRPLRIVDDSNKGS
AKYFDYLFYIDFEASMAEPRAQYALGHLQEFARFIRVLGCYPMDTTI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaggctgtaccaatctgggtttgtgttaatcactctctttctcaattgggt
ctcttcgatttcgttcaaaacaagaagaaaacgcctgctttcaccaattgtagggttaat
ctttcgaaattcaggaaatgggaatgcttaggtttgaaattggctgaacccgaaagggca
caaacccatgtcgaagatgacaagcctttgagtccatctgatttgggttcaacttctaca
gatgaaaggattcaagacacccagatcaccgaatcgaaagggtttcataaagatttgaat
tctttaccaaagccgttatcagctactgatcttgtctcttctggtaacgatggctcaaag
gtccgagttgcttatcagggtctgccaggtgcatatagcgaggctgcggctcttaaagca
tacccaaaatgtgaaacagtcccgtgtgaccaatttgaatcagtgttcaaggctgtcgag
ttgtggttggtggataaagccgtactcccgattgagaactctgtaggtggaagtattcat
cgaaattatgatttactccttcgccatcgactgcacattgttggtgaagtgcagatggtt
gttaatcactgtctcttgggcgtgcccggggtcaaaaaggaggagctgaagcgcgtatta
agccaccctcaggcgcttgatcaatgtgagatcgcactaaacaagttaggtgttgtgaga
gttagcgccgaagattctgctggtgcagctcagattgtagcctctgaaggcatacgagac
accggagccgttgcaagttctcgagctgcggaaatctatgggctagacattctagcgcag
acaatccaggatgatttagataatgttactcgttttctaatactagcaagagaacctata
atcccgggacccgacaagccctataagacgagcattgtatttacgttagaagaaggcccg
ggggtattattcaaagcattagctgtgtttgcgctaagggagatcaacttatcaaagatc
gagagccggccccagaggaagcgcccacttcggattgttgacgatagcaacaaagggagc
gccaagtactttgactacctattttacatcgactttgaagcttcaatggctgaacctcgt
gcccaatatgctcttggacatctacaggaattcgcaaggtttatccgtgttcttggttgc
tacccgatggatacaactatatag

DBGET integrated database retrieval system