KEGG   Cynara cardunculus var. scolymus (artichoke): 112505273Help
Entry
112505273         CDS       T05604                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr EGF Haspin_kinase EGF_CA EGF_3 APH Orthoreo_P10
Motif
Other DBs
NCBI-GeneID: 112505273
NCBI-ProteinID: XP_024964973
Position
Unknown
AA seq 424 aa AA seqDB search
MFPCHGTCINTLGNYTCECGRGYSGDAKIRDGCRRKPYHPLWLYIGVGSGLLVVLIVLSV
SYFTAKKKKLVKQREKCFKQNGGVLLEEKLKTMGGISVSCMKIFHVGELEEATDKYAEHK
ILGRGGNGIVYKGNLLDNRVVAIKKSQRLDQRQREQFINEMVILTQINHQNVVQLLGCCL
ETDVPLLVYEFVSNGTLHHHIHNRKSGVERLSWDSRLRIAHESASALAYLHSDARMSIIH
RDVKSSNILLDESYTAKIADFGASRLILLDDHDQVTTLVQGTLGYLDPEYLRTGQLTDKS
DVYSFGVVLAELLTGKKPIATNRCLAEQTLAAYFEKAMKENRMLEILEFELVKEATDEQL
KATCDLTCKCLNQLGENRPSMKKVAIQLETLRKIRKHPWVSQVNYNEMSSLMLENEPNDL
YEVP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtttccatgtcatggaacttgcattaatactcttggaaattacacatgcgaatgtgga
cgagggtattctggtgatgccaaaattcgagatggttgtcgacgtaaaccgtatcaccct
ctctggttatatataggtgtgggttctggattgcttgtagtgctgattgtattatcggtg
tcgtacttcacggccaagaaaaagaagctagttaagcaaagagagaaatgtttcaagcaa
aatgggggtgtgctattggaagagaaattgaaaactatgggtggcatcagtgtcagttgc
atgaaaattttccacgttggagagctagaagaagcgactgataagtatgcagaacataag
attcttggtagaggaggcaacggcatcgtgtacaagggaaatctgctagataatcgtgtt
gtcgcaatcaagaagtcccaaagattggatcaaagacaaagggagcaattcataaatgaa
atggtaattcttacacaaatcaatcaccaaaatgtggtgcagcttttgggatgttgtttg
gaaactgatgttccgttgctagtttatgaatttgtctctaatggcactcttcatcatcac
atccataatagaaagagtggtgtagagagattgtcttgggatagtcgtctaaggatagca
catgaatcggcaagtgctcttgcttatcttcatagtgatgcaagaatgtcaattatacat
agagatgtgaagtctagtaacatcctattggatgagagttacactgcaaaaattgcagat
tttggtgcgtcaaggttaatcctcttagatgaccatgatcaagtcactacacttgttcaa
gggacgttgggatacttggatcctgaatatttgcgtacaggccaactaacagataagagt
gatgtatatagcttcggagtggttcttgcagaactccttacaggaaaaaagcccattgct
acgaatagatgcctagcagagcaaactcttgcagcatattttgaaaaggcaatgaaggaa
aatcgaatgcttgaaattcttgaatttgaattggtaaaggaggcaactgatgagcagcta
aaagcaacatgtgacctgacatgtaaatgtcttaaccaattaggtgagaaccggcccagc
atgaaaaaagtggcaatacaacttgagacattgaggaagattcgcaagcatccttgggtt
agccaagttaactacaatgaaatgagtagcttaatgcttgaaaatgaaccaaatgatctt
tacgaagttcct

DBGET integrated database retrieval system