KEGG   Cynara cardunculus var. scolymus (artichoke): 112505655Help
Entry
112505655         CDS       T05604                                 

Definition
(RefSeq) putative protease Do-like 14
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccav01002]
    112505655
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccav03110]
    112505655
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     112505655
Peptidases and inhibitors [BR:ccav01002]
 Serine peptidases
  Family S1: chymotrypsin family
   112505655
Chaperones and folding catalysts [BR:ccav03110]
 Other chaperones and cochaperones
  DegP / HtrA
   112505655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 Tricorn_PDZ LSM StbA
Motif
Other DBs
NCBI-GeneID: 112505655
NCBI-ProteinID: XP_024965317
Position
LG 2
AA seq 436 aa AA seqDB search
MRYLLRRISLLKDNGFTRLVALAAGGSGVAYMLDSKDSDRSIRFSIPVPLRYTLSSAWGT
ADIVPDYPFPSLGPSGCGNPPISFCSASSVSATDVNKEAPFKEASEPPKPCCGCLGRDTI
ANAAARVGPAVVNLSVPTGFRGMSVGNSIGSGTIIDDDGTILTCAHVVVDFQGFSSSSKG
KVEVTLQDGRSFEGTVVNADLHADIAIVKIKSKTPLPTAKLGSSSSLRPGDWVVALGCPL
SLQNTITAGIVSCVDRKSSDLGLGGMRREYLQTDCAINGGNSGGPLVNIDGEVIGVNIMK
VMAADGLSFSVPIDSVSKILEHFKRNGRVVRPWLGLKMLDLNDMIVAQLKEKDVTFPDVS
RGVLVPMVSPGSPAERAGFRPGDVVIEFEGRPVGSIKEVIEIMGDKVGKPMKVVVKRSKN
DSFTLTVIPEEANPHM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagatatttgttgagaagaatttctttgctaaaagataatggattcactcgtttagta
gcattggctgctgggggatcaggagtcgcctatatgcttgatagcaaagattctgatagg
tcgatacgattttccattccagtaccattgcgttacacattatcttcagcatggggtaca
gcagacattgtgcccgactatccatttccttccttgggtccttcaggatgtggaaaccct
cctatatctttttgtagtgctagctcagtgtctgcaactgatgtaaataaagaagcgccc
ttcaaagaggctagtgaaccaccaaaaccctgttgtggatgtttgggccgggatacaatt
gccaatgcagctgctagagtaggccctgctgtcgtcaatctttcagttccaacaggtttc
cgtgggatgagcgtggggaacagcattggctctggaaccataatagatgatgatggtacc
atattgacatgtgctcatgtggtggttgattttcaaggcttctcatcttcatccaaagga
aaggttgaagtgacattacaagatggccgtagttttgagggtacagtggtgaacgccgat
ctgcatgctgatattgctattgtgaagataaaatctaaaactccactcccaactgcaaag
cttgggtcttcaagttcactgcgtcctggtgattgggtagtagccttgggctgccccctt
tctcttcaaaacacaattacagctggtattgtaagctgtgttgatcgtaagagcagtgat
ctgggtctcggaggaatgcggagagagtatttgcagactgattgtgccatcaatgggggt
aattctggtggacctcttgttaatattgatggagaagttataggtgttaacatcatgaaa
gtgatggcagctgatggtttgagcttttctgtaccaatcgactcggtttccaaaatttta
gagcatttcaaaagaaatgggagagtagtgcgaccctggcttggtctgaaaatgcttgat
ctaaatgatatgattgttgctcagctcaaggagaaagatgtgacgttccctgatgttagc
agaggtgttcttgtgcctatggtaagcccaggatcccctgctgaacgagctggtttccgt
ccaggagatgttgtcattgaatttgaggggaggcctgttggaagcataaaagaggtgatt
gagattatgggggataaagttggaaaaccgatgaaagttgtggtgaaaagatccaaaaat
gattcttttacattgaccgtgatacccgaggaagcaaatccacatatgtaa

DBGET integrated database retrieval system