KEGG   Cynara cardunculus var. scolymus (artichoke): 112506369Help
Entry
112506369         CDS       T05604                                 

Definition
(RefSeq) leucine-rich repeat receptor-like protein kinase PXC1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccav01001]
    112506369
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112506369
Protein kinases [BR:ccav01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112506369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 112506369
NCBI-ProteinID: XP_024966143
Position
LG 2
AA seq 438 aa AA seqDB search
MNVRRDLHPILLFCVAVLALSLNVDARTGLARDAAAAPSPNGEVSPEDTDSHVNKPGTNH
SVLWSELGLFLALLGMLAYVVNVRITRSLKEEKKAVKTSTVGGSSPKIDSPVKEVKQQQE
QEQEVGRQSGLVFFVREEEQFKLENLLDAGADMQNQNYCSSLYKVQLNNNGVYAVKRLKK
LQESYDDFDRTMTMVGKLNHPNIIPLVAYSCQGDEKLLIYKYQKKGSLLSLMERYIEGKR
DFPWKLRLSMAVGIARGLDHIYRSFEGSETIPHGNIKLSNILLDENHEALISEYGYSNFL
DPKSVCLFSNNGYTAPERCLSEQGDVFSFGVILLELLTGKIVEKSGLDLPKWVKAMVREE
WTGEVFDKEIAKVGMYAFPLLNVSLKCVAHFPENRPGIGEVLEKIMEVCNAQEDFSCSSS
VESSSQDGHALYSVAEEN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttagaagagatcttcacccgattctcttgttctgcgtcgcagttttagctcta
tctctcaatgtcgacgctagaaccggtctagcccgcgatgctgctgctgctccatcaccg
aacggtgaggtttctccggaggataccgattcacatgtgaacaaaccaggaacgaatcat
tctgttttgtggtcggagcttggtcttttcttggcgttactcggcatgctcgcttatgtg
gtgaatgtaaggatcacaagatcattgaaggaagaaaagaaggcggtcaaaaccagtacc
gttggcggctcttcccctaaaattgattctccggtgaaggaagtaaagcagcagcaggag
caggagcaggaggtcggaagacaatctgggctggttttctttgtgagggaagaggaacaa
tttaagctggaaaaccttcttgatgctggagctgatatgcaaaaccagaactattgcagc
agtctttataaggttcagcttaacaacaatggtgtttatgctgtcaagagattgaagaaa
ttgcaggaatcgtatgatgactttgatcgtacaatgacaatggtcgggaagttgaatcat
ccgaacattattccgcttgtcgcttatagttgtcagggtgacgaaaagcttctgatttac
aagtatcagaagaaagggagccttctctcgctgatggaaaggtatattgaagggaagagg
gatttcccatggaaactccggttgtctatggccgttggtatcgcgaggggtttggatcac
atatacagaagcttcgaaggctcggagacgattccccatggaaatatcaagctttctaac
attttgttggacgagaatcacgaagcattaataagtgaatacgggtactcaaatttccta
gatcccaagagcgtttgcctcttcagcaataacggttatacagccccagaaagatgtcta
tctgaacaaggggacgtgttcagcttcggagtcattctattagagctactaacaggaaag
atagtcgaaaagagcggtttagaccttccgaaatgggtgaaggcgatggtgagagaagaa
tggaccggagaggtgttcgataaggagattgcaaaggttggaatgtacgcttttcctctc
ttgaacgtttccctcaaatgcgtggctcattttcccgagaaccggcccgggattggtgag
gttttggagaagattatggaggtctgtaacgcacaagaagatttttcgtgttcatcatcc
gtggagtcgagttcacaagatggtcatgcgctttattcggtggccgaggagaattga

DBGET integrated database retrieval system