KEGG   Cynara cardunculus var. scolymus (artichoke): 112508856Help
Entry
112508856         CDS       T05604                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    112508856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccav04131]
    112508856
   03029 Mitochondrial biogenesis [BR:ccav03029]
    112508856
Membrane trafficking [BR:ccav04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    112508856
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    112508856
Mitochondrial biogenesis [BR:ccav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112508856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Cytochrom_D1 PALB2_WD40 UPF0688 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 112508856
NCBI-ProteinID: XP_024969426
Position
LG 3
AA seq 510 aa AA seqDB search
MAGDEIAIKAIKHAMRALRKRHLEEEGAHAPAFTAISKPIASQGMVWKDKAETLESELQQ
CYKAQARLSEQLVVEVAESRASKALVQEKEALIPSLENKLSQVRDECSRLTAVLEEKTKA
LELLIGENQELRAQYEEMRARANNAEAENKTLVDRWNLQKMEDSKRLNEATALYEDLLSK
IKASGLEQLARQQIDGVARRSEEGAEYYVESIIPKICKHRIVAHEGGCASIIFDNSSGKL
ISGGQDQTVKIWDTNTGLLTRTYHGCLGSVLDLAITDDNRCVIAASSSNNLYVWDANSGR
VRHTLTGHLDKVCAVDVSRLSSRHVVSSSYDRTIKLWDLNKGYCINTIIFPSNCNALSFS
ADGETIFSGHVDGHLRLWDIQTGNLLSEIAAHSLAVTSICLSRNGNRILTSGRDNLHNLF
DIRSLEVCGRLGASGNRVSSNWSRSCISPDDNYVAAGSADGCVHVWSISEANIVSTLKEH
TASVLCCSWSGLGKPLATSGRNGIICMWSH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggctggggatgagattgccataaaagcaataaagcatgccatgagagcccttaggaag
cggcatttggaggaggagggagctcatgctcccgcttttacagcaatttctaaacctatt
gcttctcagggtatggtgtggaaggataaagcagaaactcttgaatcagagcttcagcaa
tgttataaagctcaagctcgactatctgagcagcttgttgtagaagttgcggagtccaga
gcttcaaaagctttagttcaggagaaagaagccttgattcctagtcttgaaaataagctt
tctcaagtaagggatgagtgttctcgtttgactgcggttttggaagaaaagactaaagcc
ctagagttgcttatcggtgagaatcaggagctcagagctcaatatgaagaaatgagagct
agagccaacaatgccgaggctgaaaacaagacattagtcgatcggtggaatttgcagaaa
atggaggattctaaacgccttaatgaggctactgctctatatgaagatttgcttagtaag
atcaaggctagtggtctggagcaactcgccagacagcaaattgatggtgtggcccgtcgt
agcgaagaaggtgctgaatactatgtagaatcaattatacctaaaatatgtaagcacagg
atcgtagctcatgaaggtggctgtgcatccataattttcgacaacagttctggaaaattg
atcagtggtgggcaagaccagactgtcaaaatttgggacacaaataccgggttgctaact
cgaacctaccatggttgtttaggctcggttcttgatcttgccatcactgatgataataga
tgtgtaattgctgcaagtagctcaaataacctgtatgtatgggatgcaaattccggacgg
gtccgccataccctcaccggccatttagataaagtatgtgcggtagacgtgagcaggttg
tcgagccgccatgttgtgagttcatcttacgaccgcactatcaaattatgggatctgaac
aaaggttactgcatcaacactattatattcccgagtaactgcaatgcgctttctttcagt
gcagatggcgagaccattttttcaggccatgttgacggacacctgaggttatgggatata
cagacggggaacctactgagtgagattgctgcacattctcttgctgttacgtctatttgt
ctgtctagaaatggcaatagaatactgactagcgggagggataatttgcacaatttgttc
gatataaggagtcttgaagtttgtgggaggctaggagcaagtgggaacagagtttcgtct
aattggagcagatcgtgtattagtccagatgataattatgttgctgctggatctgccgat
gggtgtgttcatgtgtggtcgatatctgaagctaacatagtgagcacactgaaggaacac
acagcttcagtactatgttgttcttggagtggtcttggaaaacccctagccacctcgggc
aggaacggaatcatctgtatgtggagtcattga

DBGET integrated database retrieval system