KEGG   Cynara cardunculus var. scolymus (artichoke): 112509219Help
Entry
112509219         CDS       T05604                                 

Definition
(RefSeq) equilibrative nucleotide transporter 8-like
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccav02000]
    112509219
Transporters [BR:ccav02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   112509219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 112509219
NCBI-ProteinID: XP_024969843
Position
LG 3
AA seq 413 aa AA seqDB search
MESLHLDPPATDHQNEPKDPYCIAYIIHFLLGAGYLIPWNSFITAVDYFQFLYPAKHVSK
VFSVAYMLASMTVLSILAWCSSSGKRKLPEFRVRMNLGYALFVLALVVTQVIDWVDHRNE
IRGGSNAGFAVLVSMLVLTGCAEGLTGGSLVGATGKLPGRYMQAVVAGNASAGVLVCILR
IITKASLPHSRGGLRTSTHIYFFTSILIELLCILCCNLLHKLPAIRRYTARPSHSHLDNQ
PKHNSDDHHRPKTLSVLKKLQWLLMSVVTIYVVTLSIFPGYLSENVKSTQFGDWYPLFLI
TIYNAGDFSGKCVTAVYVVKRKRWVIWGCMMRVLFYLLFFGCVFGPKWFRNEVVVVVLTL
LLGVSNGYLTSVLMIVGPKSVEVEESHVAGIAMSLFLGIGLVIGSGLGWLWDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcctacatctcgatccgccggcgaccgaccatcagaatgaaccaaaagaccct
tattgcatcgcctacatcatccactttctactcggcgccggctatctcattccatggaac
tccttcatcaccgccgtcgattacttccagtttctttatccggcaaagcacgtctccaag
gtattctcggtggcttatatgctggcctccatgacagttctttctattctcgcgtggtgc
tctagctccggcaagagaaagctgccggaatttagagtgaggatgaacttgggttatgct
ttgtttgttttagctctcgtcgtaacacaagtcattgattgggttgatcaccggaacgag
ataagaggaggttcgaatgccggttttgcggttctggtttcgatgctggttctaaccggt
tgtgccgaagggttaaccggtggaagcttggtcggcgccaccggaaaacttcccggacgg
tacatgcaggctgttgttgccggaaatgcttctgccggtgttttggtatgcatcttgagg
atcataacaaaagcatcacttccacattcaagaggaggtctacgaaccagcacccacatc
tatttcttcaccagcatactcatcgaactcctttgcatcctctgctgcaacctcctccac
aaactaccagccatccgccgttacaccgcccgtccatcccactcccacctcgacaaccaa
ccgaaacacaactccgacgaccaccaccgaccaaaaacgctttcagtcttgaagaaactc
caatggctacttatgtccgtggtcacaatctacgtcgtgacactatcgatcttcccagga
tacttgagcgagaacgtgaaatcgacgcaatttggcgactggtatcctttgttcttgata
accatttacaatgccggagatttttcaggcaagtgtgtgactgcggtttatgtggttaag
aggaaacgatgggtgatatgggggtgtatgatgagggtgttgttctatctgctctttttc
ggttgcgtttttggaccgaaatggtttcgaaacgaggttgtggtggtagttttaacgttg
ttgttgggtgttagcaacgggtatctgacgagcgtgcttatgatcgttggacctaaatcc
gtggaagttgaggaatcgcatgtcgctggcatcgccatgagtttgtttttgggaatcggg
ttagtgattgggtcgggtttaggttggttatgggacctttga

DBGET integrated database retrieval system