KEGG   Cynara cardunculus var. scolymus (artichoke): 112511026Help
Entry
112511026         CDS       T05604                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g09600
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccav01001]
    112511026
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112511026
    2.7.11.23  [RNA-polymerase]-subunit kinase
     112511026
Protein kinases [BR:ccav01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112511026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH FTA2 DUF2385 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 112511026
NCBI-ProteinID: XP_024972158
Position
LG 4
AA seq 440 aa AA seqDB search
MQKIKSIVGGTQAAQKAAGWPSWLTSVASEAIQGWVPRSAESYEMLNKIGQGTYSSVYRA
RDLQTDKIVAIKKVRFVNMDPESVRFMAREICILRRLDHPNVMKLQAIVTSKFSGTLYLV
FDYMEHDLAGLLTSPKVKKFTEPQIKCYMQQLLRGLEHCHSRGILHRDLKGSNVLLDNNG
ILKIGDFGLAARFEPGQREPLTSRVVTLWYRAPELLFGSTSYGVGIDMWSAGCILAELFT
GRPIMPGRTEVEQIHKIFKLCGSPSEEYWRKSKLPLATSFKPKKPYKRRIVETFQQHLSS
SALALLDALLSIEPADRGTATSALSSEFFTTPPLPCDPSSLPEYPPSKEFDTRYREEEAR
RQKAEAMKGHVPESVRNGAVELKAQPKGQVPSLELESFQFLLMKSIIVIMANLCITGADC
SEKLQSSTGKRHREEWIRLL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagataaaaagcatagtaggtggtacccaagctgcacaaaaagcagcaggatgg
ccgtcgtggctaacttctgttgcttcagaggccatacaaggatgggttccccgaagtgcg
gagtcatatgaaatgctaaacaaaattgggcaaggcacatacagtagtgtttacagagcc
cgtgatctgcaaactgataaaatcgttgccataaagaaagtgcgtttcgtgaatatggat
ccagaaagtgtccgttttatggccagggagatttgtatattgcgaagattagatcaccca
aatgttatgaagcttcaggctatagttacttcaaagttttcaggcaccttgtaccttgtt
tttgattatatggagcatgatcttgctgggcttttaacatcaccaaaagtcaagaagttc
acagagccacagattaaatgttatatgcaacaacttcttcgtggattggagcactgtcat
tctcgtggtattctgcatcgagacttaaagggttcaaatgttctacttgataacaatgga
attctcaagatcggagattttggtctggctgcacgctttgagcctggccaacgtgaacca
ttaactagtcgtgttgtaactttatggtatagagctcccgagcttttatttggttcaaca
tcatacggcgtcggcattgatatgtggagtgctggctgcatccttgcagaactctttact
ggaaggcctatcatgcctggaagaacagaggttgaacaaatacataagatcttcaagctt
tgtggttcaccttcagaagaatactggagaaaatcaaagttacctctggcaactagtttt
aaacctaagaaaccttataagcgacgcattgttgagacattccaacagcacctgtcttct
tctgctttggctcttttagatgccctcctttcaattgaaccagccgatcgtggtactgca
acttctgcactctcgagtgagttcttcacaacaccacctctcccttgtgatccatccagc
ttaccagaatatcctccaagcaaagagtttgatactaggtaccgggaagaggaagctaga
aggcagaaagctgaagctatgaaaggacatgtgccagaatctgttagaaacggtgctgta
gaattgaaagcacaacctaaaggacaggtgccttctttagaacttgaatcttttcagttt
cttcttatgaaatccatcattgtcataatggccaacttatgcattacaggggcagattgt
agcgagaaactacaatcctcaacaggaaaacggcatagggaagaatggattcgtctacta
taa

DBGET integrated database retrieval system