KEGG   Cynara cardunculus var. scolymus (artichoke): 112511105Help
Entry
112511105         CDS       T05604                                 

Definition
(RefSeq) coatomer subunit alpha-1-like
  KO
K05236  coatomer subunit alpha
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccav04131]
    112511105
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccav04147]
    112511105
Membrane trafficking [BR:ccav04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    112511105
Exosome [BR:ccav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112511105
  Exosomal proteins of bladder cancer cells
   112511105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 112511105
NCBI-ProteinID: XP_024972314
Position
LG 4
AA seq 1217 aa AA seqDB search
MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
QSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW
NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALKKKTVSPADDILR
LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
VDTLRGHMNNVSCVLFHARQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILGCHP
EMNLLAAGHDSGMIVFKLERERPAFSVSGDSLYFVKDRFLRFYEYSSQKDTQILPIRRPG
SISLNQGPRTLSYSPTENAVLICSEVDGGSYELYIIPKDSFSRGDTVQEAKRGIGGSAVF
VARNRFAVLEKSTNQVLVKNLKNEIVKKSPLPVVTDAIFYAGTGNLLCRAEDRVFIFDLQ
QRMVLGDLQTSFVRYVVWSNDMESVALLSKHSIIIADKKLVHRCTLHETIRVKSGSWDDN
GVFIYTTLTHIKYCLPNGDSGIIRTLDVPVYITKIFGNTIFCLDRDGKNRPIIIDSTEYI
FKLSLLKKRYDHVMSMIRNSELCGQAMIAYLQQKGFPEVALHFVKDERTRFNLALESGNI
QIAVASAKEIDEKDHWYRLGVEALRQGNSGIVEYAYQRTKNFERLSFLYLITGNLDKLSK
MMKIAEVKNDVMGQFHNALYLGDVQERIKILINAGHLPLAYATAKTHGLNDIVEDLADKL
EGNVPSLPSGGSASLLMPPTPVLCGGDWPLLRVMKGIFEGGLDNIGRGTNEEYEDAGDAD
WGEDVDIVDVENIQNGDISMVLDDEEAPEENEEGGWDLEDLELPPDIETPKATTAARSSV
FVAPTAGMPVSQIWVQKSSLAAEHAAAGNFDTAMRLLSRQLGIKNFAPLKSLFIDLHMGS
HTYLRAFSSAPLISLAIERGWSESASPNVRAPPALVFNFPQLEEKLKAGYKATTTGKFTE
ALRLFLGILHTIPLIVVESRREVDEVKELIIIVKEYVLGLQMELKRRELKDNPVRQQELA
AYFTHCNLQLPHLRLALMNAMTVCYKAGNLITASNFARRLMETNPTAENQTRTARSVMQA
AERNMKDSTQLNYDFRNPFVVCGATYVPIYRGQKDVLCPYCSSHFVLSQEGQLCTVCDLA
VVGSDASGLLCSPAQIR
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaagtttgagaccaagagtaatagagtgaaaggtctgagtttccacagcaag
cggccatggatcttggctagccttcacagtggtgtgatccagctatgggattaccggatg
ggcactctcattgatcgttttgatgagcatgacggccccgttcgtggcgtgcactttcat
caatcacagcctcttttcgtttccggaggagatgattacaagatcaaagtatggaactat
aaactgcatcggtgtttgtttacgctgcttggccatcttgattatatacgcacagttcag
tttcaccatgagaacccctggattgttagtgctagtgatgatcaaactatccggatatgg
aattggcaatctcgtacttgtatatccgttttgactgggcacaaccattatgtaatgtgt
gctttgttccatccgaaggaggacctcgtggtatcagcatcattggatcagaccgttcga
gtttgggatattggtgccctgaagaagaaaacagtttcccctgctgatgatatccttcgg
ctgagtcagatgaatacagatttttttggaggggttgatgctgttgtgaagtatgtcttg
gagggccatgatcgaggagtcaattgggcatcattccatcccactcttcctcttattgtt
tcaggagctgatgatcgccaagttaaaatctggcgaatgaatgatacaaaagcttgggaa
gtagacacattgagaggtcacatgaataatgtatcatgtgttcttttccatgcaagacag
gacattatagtatcaaactcagaggataaaagtatacgtgtttgggatgctacaaaaagg
acaggcctgcaaactttccgcagggagcatgacaggttctggattcttgggtgtcatcct
gagatgaaccttctggcggctggccatgatagtggtatgattgttttcaagttggagaga
gaacgcccagctttctctgttagcggtgattccctgtacttcgtgaaagaccgttttctg
cggttctatgagtactcttctcagaaagacactcaaatattaccaatccgtaggcctggg
tctatcagcttgaaccagggtcctagaactctctcttatagccctactgaaaatgcggtt
ctaatatgttcagaggtagatgggggatcttatgaactctatatcatacctaaagatagt
tttagtagaggtgatacagttcaagaggcaaaacgaggaattgggggatctgcagttttt
gtggctcgaaataggtttgcagttcttgagaagagcaccaatcaagtgttagtcaagaac
ttaaagaatgagattgtgaagaagagtcctcttcctgttgtcactgatgctatattctat
gccggtacaggtaacttgttatgcagggcagaggatagagtgttcatctttgaccttcaa
cagcgaatggttcttggtgaccttcaaacttcttttgtaagatatgttgtttggtcaaat
gacatggagagtgttgctttgcttagcaaacattcaataatcatagctgataagaagctt
gttcaccgctgcacccttcatgaaacaatccgagtcaagagtggatcctgggatgataat
ggtgtgttcatttacacaaccctaacccatatcaagtactgccttcctaatggggacagt
ggaatcatcaggacacttgatgttccggtgtacatcacaaagatatttggaaatacaatt
ttttgcttggaccgagatgggaaaaaccgcccaataattattgattcaactgagtatatc
ttcaagctatctctgctgaaaaagagatatgaccacgtaatgagcatgataaggaactca
gagctgtgcgggcaagccatgattgcatatctccagcaaaaaggtttcccagaggttgct
ctccatttcgtgaaggatgagagaactcgcttcaatttagcacttgaaagtggaaacatc
cagatagctgttgcttctgcaaaagagattgatgagaaagatcactggtataggttgggc
gttgaggcccttcgtcagggcaattctggtattgttgaatatgcataccagaggacgaaa
aactttgagaggctatccttcctgtatctgataacaggaaatttggataaattgtccaaa
atgatgaaaatcgctgaggtaaaaaatgatgttatggggcagttccataatgctttgtac
ctgggtgatgtccaagagcgaatcaagattttgataaatgctggtcatctaccactagca
tatgctactgctaagacccatggattgaacgatattgtcgaagaccttgctgataaactt
gaaggtaatgttccttctttgcccagtggtgggtctgcttctcttttgatgcccccaact
cccgtcttatgcggtggagactggccattactgagggtcatgaaagggatctttgagggt
ggccttgacaatattggaaggggtacaaatgaagagtatgaagatgctggtgatgctgat
tggggtgaggatgtggatattgtggatgtagagaacattcagaatggagatatcagcatg
gtgctggatgatgaagaagcacctgaagaaaatgaagagggaggttgggatctcgaggat
cttgaacttcctcctgatattgaaacccccaaagctacgactgctgcccgctcttcagta
tttgtggcacctactgctggtatgcccgtcagccagatttgggtgcagaaatcatctctt
gctgctgaacatgcagcagctggaaactttgacactgcgatgcgcttgctaagccggcag
ctcggaataaagaactttgcaccgttaaaatcattgtttattgatcttcacatgggaagt
catacttacttgcgtgcgttctcatcagctccattgatctccctggccatcgagaggggt
tggagcgaatcagcaagtcctaatgtccgggcccctcctgcactcgtgtttaatttccct
cagttggaagaaaagctcaaggctggttacaaagccaccaccactgggaagttcactgaa
gctttgcgactttttctgggtattcttcatacgattcccctgattgttgtcgagtcaaga
agagaggtggatgaagttaaagagttgattattattgtgaaagagtatgttctgggttta
cagatggaacttaaaagaagagaactgaaggacaacccggttcgtcaacaggaactggcc
gcttacttcactcactgtaaccttcagctaccacacttgagacttgccttgatgaatgct
atgactgtatgctacaaggctggtaatctaatcacagcatcaaactttgccaggaggctc
atggagaccaacccaactgcagaaaaccaaaccagaactgcccgttcagttatgcaggct
gctgagaggaacatgaaagattccacacagctgaattatgacttcagaaatccatttgtc
gtttgtggagcaacttatgtccctatataccggggacagaaggatgtattatgcccatac
tgcagttcacactttgttctttcccaggaagggcagctttgtactgtttgtgacctagcc
gtggtcggatcagatgcttctggtttgctatgttctccagcacagatcagatga

DBGET integrated database retrieval system