KEGG   Cynara cardunculus var. scolymus (artichoke): 112512658Help
Entry
112512658         CDS       T05604                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav03040  Spliceosome
ccav04141  Protein processing in endoplasmic reticulum
ccav04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112512658
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112512658
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112512658
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccav01009]
    112512658
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccav03041]
    112512658
   03009 Ribosome biogenesis [BR:ccav03009]
    112512658
   03110 Chaperones and folding catalysts [BR:ccav03110]
    112512658
   04131 Membrane trafficking [BR:ccav04131]
    112512658
   03051 Proteasome [BR:ccav03051]
    112512658
   03029 Mitochondrial biogenesis [BR:ccav03029]
    112512658
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccav04147]
    112512658
Protein phosphatases and associated proteins [BR:ccav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112512658
Spliceosome [BR:ccav03041]
 Complex B
  Other components
   Prp19 complex
    112512658
 Complex C
   Prp19-CDC5 complex
    112512658
Ribosome biogenesis [BR:ccav03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112512658
Chaperones and folding catalysts [BR:ccav03110]
 Heat shock proteins
  HSP70 / DNAK
   112512658
Membrane trafficking [BR:ccav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112512658
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112512658
Proteasome [BR:ccav03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112512658
Mitochondrial biogenesis [BR:ccav03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112512658
Exosome [BR:ccav04147]
 Exosomal proteins
  Proteins found in most exosomes
   112512658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C StbA BcrAD_BadFG PilM_2 GIT_SHD
Motif
Other DBs
NCBI-GeneID: 112512658
NCBI-ProteinID: XP_024974499
Position
LG 5
AA seq 698 aa AA seqDB search
MASSTAQIHALGATSFVSTNNSPKTVFFGKGLSKSVSFSHQKSFLKLKKSRTNGPLRVVA
EKVVGIDLGTTNSAVGAMEGGKPVIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQAVVN
PENTFFSVKRFIGRKMSEVDEESKQVSYTVVRDENGNVKLDCPAIGKQFAAEEISAQVLR
KLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGF
ERKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAASFKK
DEGIDLLKDKQALQRLTETAEKAKMELSTLTQANISLPFITATADGPKHIDTTLTRAKFE
ELCSDLLDRLKRPVENSLRDAKLSFKDIDEVILVGGSTRIPAVQEVVKSLTGKEPNVTVN
PDEVVALGAAVQAGVLSGDVSDIVLLDVTPLSIGLETLGGVMTKIIPRNTTLPTSKSEVF
STAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSV
TAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDKEKRDAIDTKNQADSVVYQT
EKQLKELGDKVPAPVKEKVEAKLGELREAITGGSTQTIKDAMAALNQEVMQLGQSLYNQP
GGPGAGPTPPGAEPSESSSSSEKGPEGDVIDADFTDSK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaacagctcagattcacgctcttggagccacttcctttgtttcaactaat
aattcacccaaaacagtcttctttggcaaaggattatccaaatccgtttcgttttcgcat
cagaaatcatttttgaagctcaagaagagcagaaccaatggcccgcttagagttgtggct
gagaaggttgttggaattgatctggggacgacaaactctgccgtcggtgcgatggaaggt
gggaagcctgttattgtgactaacgctgaagggcagaggactacgccgtcggtggtggcg
tatacaaagagcggagataggttggtgggccagattgccaagaggcaggctgttgtcaac
cctgagaatacgttcttttcggtgaaaaggtttattggaaggaagatgtcggaggtggat
gaggagtccaaacaggtttcttacacggtggtgcgtgatgagaatggaaacgttaagctt
gattgccctgctatcggaaagcagtttgctgctgaagaaatttcagcacaggttttaaga
aagcttgtggatgatgcttcaaagtttctgaacgataaggtcacaaaggctgttgtgacg
gttcctgcttattttaacgactctcaaagaacagcaaccaaggatgctggtcgaattgct
ggtcttgaagtccttcgtatcatcaatgaacctacagctgcctcactagcttatggcttc
gaaaggaagaacaatgaaaccatattagtttttgaccttggaggtggtacttttgatgtt
tcagttcttgaggttggtgatggagtctttgaggtgctgtctacttccggagatacacac
cttggtggtgatgattttgacaagagggttgttgattggcttgctgcaagcttcaagaaa
gatgagggcattgatctattgaaagacaagcaggctctgcagcgcttgactgagacagct
gaaaaggctaagatggaactatcaactttgacacaggcaaacattagtttgccattcatt
acagccactgctgatggccccaaacacattgatacaacccttacaagggcaaagtttgag
gaactatgctcagacctgctggataggcttaaaagaccagttgagaattctctgagggat
gcaaagttgtcgttcaaagatatagacgaggtgatacttgttggtggttcaacacgtatt
ccagctgttcaggaagttgttaagagcctgaccggaaaggaaccaaacgttaccgttaat
ccagatgaagttgttgccttgggagctgcagttcaggctggtgttttatcaggagatgtg
agcgacattgttcttttagatgtaacaccattatccattgggctagaaactcttggtggt
gtgatgaccaagatcatcccaagaaatacaactcttccaacttcaaagtcggaggttttc
tctacagctgctgatgggcaaacaagcgttgaaattaacgtccttcagggtgagagagag
tttgtgagggacaacaagtctcttggtagcttccgacttgatggcatcccacctgcccct
cgtggagttccacaaattgaggtcaaatttgatattgacgcaaatggtatcctatctgtt
actgccattgacaagggcacaggaaagaagcaagatatcaccattactggtgctagcaca
ttacctagtgatgaggtagagagaatggttagtgaagctgaaaagtttgcaaaggaagac
aaggaaaaacgagatgcgatagacacaaagaaccaggccgattcagtggtgtaccagaca
gagaagcagctgaaggagttgggagacaaggttcctgcacctgtgaaggagaaggttgag
gctaaactcggagagctaagggaagctataacagggggctcaacacaaaccattaaagat
gccatggctgcccttaatcaagaggtgatgcagctggggcagtcgctatacaaccagccg
ggtggtccaggggcaggcccaacaccacctggtgcggagccttcagaatcatcatcgtca
tcggagaagggacctgaaggagatgtgatcgatgctgattttacggacagcaagtga

DBGET integrated database retrieval system