KEGG   Cynara cardunculus var. scolymus (artichoke): 112512797Help
Entry
112512797         CDS       T05604                                 

Definition
(RefSeq) uncharacterized protein At4g19900-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ccav00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ccav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    112512797
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    112512797
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccav01003]
    112512797
Enzymes [BR:ccav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     112512797
Glycosyltransferases [BR:ccav01003]
 Glycan extension
  P blood group
   112512797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB Glyco_trans_4_2 dUTPase
Motif
Other DBs
NCBI-GeneID: 112512797
NCBI-ProteinID: XP_024974707
Position
LG 5
AA seq 429 aa AA seqDB search
MIKVSSLKRAEQRRRLIGLCRARFHLFSAISVGAIFFTYIIKTDRFTSDISIHSAPITIT
PFHPHVFNNHTFIVRQIKLTSYSIPKEVAPETELEDDRSPLVQPINLTKEQRISGFKDIL
PKFDILKSTRLARRFHKRAQYFFKDSCKIRFFMTWISSSSSTVFGDREFLAVDALFKSNP
DSCLMILSNTMDSVHGFRILKHLTDRGYRVQAITPDLDFLFKNTPAQSWLHQIKNGKRDP
GKIPLAQNLSNLIRLAILYKYGGVYLDTDFVILKDFSSLKNSIGAQSATPSGNWTRLNNA
VLIFDKNHDLLYKFMEEFASTFNGNRWGYNGPYLVSRVVEREETTVLKLNFRVLPPMAFY
PVDWVHVGGFFTPPTNRVHRRWVEAKMGQLSKSTYGVHLWNKQSSRFKIEEGSIMARLIA
NHCVICNIK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtttcttctctgaaaagggcggagcaacgacggcggctgatcggcctctgc
cgtgccagattccatctcttctccgccatctccgtcggagctatcttcttcacctacata
ataaaaacagatcgattcacttccgatatttccattcattctgcaccaataaccataacc
ccatttcatcctcatgtgttcaacaatcataccttcatcgtacgacaaataaagttgact
tcgtattcgatacctaaggaagttgctccagaaactgagttagaagatgatcgtagtccg
ttggttcagcccattaatctgaccaaagaacaaaggatcagtgggttcaaagacattctt
ccaaaattcgatattctcaagtcaacaaggctggctcgaagattccacaaacgggcacaa
tatttctttaaagatagttgcaagattcggttctttatgacgtggatatcatcatcttca
tctactgtttttggagatagagaatttcttgctgtagatgctttgtttaagtcgaatcca
gacagctgtttgatgatactttcaaacactatggactcagttcacgggttccgaatcttg
aaacacttgactgatcgtgggtatcgagttcaagccataacaccggacttagatttcttg
ttcaagaacacaccagcgcaatcttggctccatcaaatcaagaatgggaaaagagaccct
ggtaagatccctttagcacaaaacctgtcgaatttgatcagactggcgattctttacaag
tatggaggcgtttatttggacacagattttgtcattttgaaagattttagcagtctgaag
aactcaattggagcacaaagtgcaaccccatctggaaactggactagactgaataacgca
gtattgatctttgacaaaaaccatgatttgttatacaaattcatggaggaatttgcatca
acctttaatggtaacagatggggttacaacggaccttatcttgtatctagagtggtggaa
agagaagaaacaacagttctcaagttgaattttagggttttacctccaatggcgttttat
ccggttgattgggtacatgttggagggttttttacacctccgacgaatcgggttcaccgg
agatgggttgaagccaagatgggtcaactaagcaagtcaacttatggagttcacctgtgg
aacaagcaaagtagcagatttaagatagaagaaggaagcatcatggctagactgattgct
aatcattgtgtcatctgcaatataaaataa

DBGET integrated database retrieval system