KEGG   Cynara cardunculus var. scolymus (artichoke): 112513789Help
Entry
112513789         CDS       T05604                                 

Definition
(RefSeq) serine/threonine-protein kinase PCRK1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccav01001]
    112513789
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112513789
Protein kinases [BR:ccav01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112513789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like APH DUF1045
Motif
Other DBs
NCBI-GeneID: 112513789
NCBI-ProteinID: XP_024975917
Position
LG 5
AA seq 454 aa AA seqDB search
MKCFHFISGDRRTDDDDGVLSRSSTRVSWARSLSVASTSFDTTRRSEFDLSSNSRDLGDS
EAFSELLSQRRANDLRVFKFAELKAATKGFNRSLVIGEGGFGCVYRGVVKAAVSDEGSDG
DRCLDVAIKQLSRNGFQGHKEWINEVNFLGVVNHPNLVKLVGYCAEDDERGIQRLLVYEL
MRNKSLEHHLLGRGESPLSWMVRLQIAQGAARGLAYLHEEMDFQLIFRDFKTSNILLDED
FNPKLSDFGLARQGPAAGLSHVSTVVVGTIGYAAPEYLHTGRLTSKSDVWSFGVVLYELI
TGRRAVERNLPRNEQKLLEWVKPYISDSKKFHLLLDPRLEGDYSLKSAHKLSCLANKCLT
KNPKSRPKMSEVVEMLGKIINDTSPPQPETESQLVTTEEPEEAAVETDSGKQEVSANNYM
KKVFDFKELVTLRNRSILRMEWRHWPPGMVRHSA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgttttcacttcattagtggtgataggagaaccgacgatgacgacggcgtcctt
tccaggtcgtctaccagggtatcgtgggctcgttccctcagcgttgcctccaccagcttt
gacacaactcgtcgttcggagtttgatctgagcagcaactctagagacctcggtgattct
gaagcgttctctgagctcttatctcagcgccgtgcgaacgatctgcgagtttttaagttc
gccgagttgaaggctgcgaccaaggggttcaatcgatcgcttgtgatcggtgagggagga
tttggttgcgtttacagaggagttgttaaagccgccgtctccgatgaaggtagcgatggt
gaccggtgtttggatgttgctatcaagcagttgagtcgtaatggattccaggggcataag
gaatggattaatgaagtgaactttttgggggtagtcaaccatccaaaccttgtaaagttg
gtgggatattgtgcagaggacgatgaaagagggattcagcggcttttagtgtatgagctt
atgcgcaataaaagtttggaacaccatctattgggtcgtggagagtctcctctttcatgg
atggtccgtttacaaattgctcaaggagcagctcgtggtttggcttatctacatgaagaa
atggatttccagctaatctttcgcgatttcaaaacttcgaacattcttctagatgaagac
ttcaacccaaaactctcagactttggacttgctagacagggtccagcagctggactgagc
catgtttcaacagtcgtggttgggacgataggttatgcagctccggagtatcttcacacc
ggtagactaacatcaaaaagcgacgtttggagctttggggtggtcctctacgagcttatc
acgggcaggcgagcagtagagcggaacttgccacgaaacgagcagaaactcttggaatgg
gtgaaaccttacatctcagattcaaaaaagttccatcttttattagacccacgtctcgaa
ggagactactccctcaaatcagcccataaactttcctgcctagccaacaaatgcctcaca
aagaaccccaaatcccgacccaaaatgagtgaagtggtcgagatgcttggaaaaatcatc
aacgacacgtcaccaccacaacccgaaaccgaatcccaactcgttacaacagaagaaccc
gaagaagctgcagtggaaactgattcaggaaaacaagaggtgagcgctaataattacatg
aagaaggtttttgatttcaaggaattggttactttgaggaacagatcaattttacgaatg
gaatggcgacattggccaccggggatggttcgacacagcgcgtga

DBGET integrated database retrieval system