KEGG   Cynara cardunculus var. scolymus (artichoke): 112515273
Entry
112515273         CDS       T05604                                 

Definition
(RefSeq) germacrene A oxidase
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00909  Sesquiterpenoid and triterpenoid biosynthesis
ccav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    112515273
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.95  germacrene A hydroxylase
     112515273
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 112515273
NCBI-ProteinID: XP_024977750
Position
LG 7
AA seq 486 aa
MVLTTSIVVASILFILFKLATRPKSNKNLLPEPWRLPIIGHMHHLIGTMPHRGVMDLSRK
YGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPYGE
YWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVKASGSGRPVDLSENIFKMIATIL
SRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDN
LINNIVAEHPGNTSSKSNETLLDVLLRLKDSPEFPLTADNVKAVILDMFGAGTDTSSATV
EWAISELIRCPRAMEKVQAELRQALKGKDKIKEEDIQDLSYLDLVIKETLRLHPPLPLVM
PRECRQPVNLAGYNIADKTKLIVNVFAINRDPEYWKDAESFIPERFENSPTNVMGAEYEY
LPFGAGRRMCPGAALGLANVLLPLATILYHFNWKLPNGASHEQLDMTESFGATVQRKTHL
VLVPSF
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggtactcactacttccattgttgttgccagcatcctcttcatccttttcaagcttgca
actcgtcccaaatccaacaaaaacctccttccagagccatggagactccccatcatcggt
cacatgcatcatttgattggtacaatgccacatcgtggtgttatggacttatctagaaag
tatggatctttgatgcatttacagcttggtgaggtttcaaccatcgtggtatcgtctccg
aaatgggcaaaagagatcttaacgacctatgatattacgtttgcaaacaggcccgagaca
ttgacaggcgagattattgcatatcataacacagatatcgttcttgcaccatacggtgaa
tactggcggcaattgcgaaagctttgcactttggagcttttaagtgtcaagaaagtgaag
tcgtttcaatcgcttcgagaagaagagtgctggaatttggttcaagaagttaaagcatcg
ggatcagggagaccagtcgatctttctgagaacattttcaagatgattgctacaatattg
agtcgagctgcatttgggaaaggaatcaaggatcaaaaagagttcacggagattgtgaaa
gagatcttgaggcagacgggaggtttcgatgtggctgatatttttccttcgaaaaagttt
cttcatcatctttcgggcaagagggctaggttaaccagcatacacaagaagctcgataat
ttgatcaacaacatcgttgccgaacaccccgggaacacctcgagtaaatcgaacgagacc
ctgctcgatgtgctgctaaggctcaaagatagccctgagttcccattgacagccgataac
gtgaaagctgtcatcttggatatgttcggagcaggcacagacacttcatcggccacagtc
gaatgggcgatttccgaactgataaggtgtccgagagcaatggagaaagtacaagccgaa
ctaagacaagcactcaaaggaaaagacaagatcaaagaggaagatattcaagatctcagc
tatttagacctagtgatcaaagaaacattaaggttgcaccctcctctacccttggttatg
ccaagagaatgccgacagcccgtaaatttggctggatacaatattgccgacaagaccaag
cttattgtgaatgtcttcgccatcaatagagaccctgaatactggaaagacgctgaaagt
ttcatcccagaaaggttcgaaaacagccctacaaacgtcatgggagccgaatatgagtat
ctgccatttggggcgggaagaagaatgtgtccaggagccgcgctgggtttagccaacgtg
ctgctcccgctggctaccattctttatcacttcaactggaaactcccaaatggtgctagc
catgagcaactagacatgactgagagctttggagccactgttcagaggaagactcatttg
gtactggtaccaagtttttaa

DBGET integrated database retrieval system