KEGG   Cynara cardunculus var. scolymus (artichoke): 112516724Help
Entry
112516724         CDS       T05604                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112516724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccav03041]
    112516724
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112516724
Spliceosome [BR:ccav03041]
 Complex C
  Other components
   Step II factors
    112516724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD AAA_14 AAA_16 PhoH ABC_tran
Motif
Other DBs
NCBI-GeneID: 112516724
NCBI-ProteinID: XP_024979696
Position
LG 8
AA seq 1191 aa AA seqDB search
MVSRTKEPSLKKLEYLSLVSKVCTELESHLGFGDKVLAEFITEIGRKCGTVDEFDSKLKE
NGAEMPDYFVRTLLKIIHAILPPKAKSGSVKDTGKNDGGGSKSNFPALNIGDSKDRVKAL
EKEIEMEAKERIRKNGGDEYEGRSQRDRDGDRSRGRDKRGSQKVRDDDDMDDRYDRRRGD
KDDRGNHGGRERHRDRDRDRKYDRARDEDDIDRRDNEKDRSEKKSYGHQSDKPELYQVYK
GRVSRVMDSGCFVQLSDIKGKEGLVHVSQMATRRISNAKDVVKRDQEVFVKVIAISGQKL
SLSMRDVDQNTGRDLLPLKKSGDDDSLRTNPSSGSNNAVSTSRTGLSGIRITDEDVGVPS
RRPLKRMSSPERWEAKQLIASGVLSVKEYPMFDEETADGMLYQEEGGDEELEVELNEDEP
AFLQGQSHYSMDMSPVKIFKNPEGSLSRAAALQSALIKERREVRDQQQRTMLDSIPKDLN
RPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSLQEQRQSLPI
YKLKKELVQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVA
KRVAEEFGCRLGEEVGYAIRFEDCTGPETVIKYMTDGMLLREILIDENLSQYSVIMLDEA
HERTMHTDVLFGLLKDLVKRRPDLRLIVTSATLDAEKFSAYFFSCNIFTIPGRTFPVEIL
YTKQPESDYLDAALITVMQIHLTEPEGDVLVFLTGQEEIDHACQCLYERMKGLGKNVPEL
IILPVYSALPSEMQSRIFEPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNP
KQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAFNNEMSPTSIPEIQRINLGL
ITLNLKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDP
PLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQRRAKFFQPEGDHLTLLA
VYEAWKAKNFSGPWCFENFVQARSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAI
TAGFFFHAARKDPQEGYRTIVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVAV
VDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgcgaacaaaagagccgagtttgaagaaactcgagtatctttcactcgtatcg
aaggtatgtacggagcttgaatcgcatttagggtttggtgataaagtattggctgaattt
atcaccgagataggacgaaagtgtggaacggtggatgaattcgatagtaagttgaaagaa
aacggtgctgaaatgccggattactttgttcggactttgttgaaaataatccatgctatt
ttgcctccaaaggcgaaatcagggtctgttaaggatactggtaagaatgatggtggtgga
tcgaagtcgaattttccagctttgaatattggggatagtaaggatcgggtgaaggcgttg
gagaaagagattgagatggaagctaaagagaggattaggaaaaatggtggagatgaatat
gaaggcaggagtcagagagacagggatggagatcgaagtagaggtagggataagaggggc
agccagaaggtcagagacgatgatgatatggatgatagatacgataggcgaagaggagac
aaagatgatagaggtaatcatgggggtagggaaagacacagggaccgagatagggatcgt
aaatatgatcgtgcaagggatgaagatgatattgatcggagggataacgaaaaagatagg
agcgagaagaagagttatgggcaccaatcagataaacctgaactttatcaggtctataaa
ggcagggtgtctagggtaatggatagtggttgttttgttcagcttagtgatatcaagggt
aaagagggtttggtccacgtgtcacaaatggctacaaggagaatatctaatgcaaaagat
gttgttaagcgggatcaggaggtttttgtgaaagtgattgcaatatcaggtcagaaattg
tctctctcaatgagggatgttgatcagaacactgggagggacttgctgccattgaagaag
agcggtgatgatgattcattaaggaccaacccctcgagtggatcaaacaatgctgtgtct
acatccaggacaggactctcagggataaggattacagatgaggatgttggggttccttca
cgcaggcctttgaagagaatgagttctccggagaggtgggaggcaaagcagttgattgct
tcaggtgttctaagtgtgaaagagtatcctatgtttgatgaagaaactgctgatggaatg
ctttatcaagaagaaggtggtgatgaagagcttgaggttgagttgaatgaagatgaacca
gcctttttgcaagggcagagccactattcaatggatatgtcacctgtcaagatcttcaaa
aatcctgagggttctttgagtcgtgcagcagccctacaatctgctctcataaaagaaagg
agagaagtgagggaccagcagcaaagaacaatgctcgactctatcccaaaagatctgaat
cgtccatgggaagacccgatgcccgaaacaggtgagagacatctggcacaggagctgagg
ggagttgggttgtcagcatacgatatgcctgaatggaagaaggatgcttttggtaaagca
ttaacatttggtcaaagatcaaagctttctctccaagaacagaggcaaagcttgcctata
tacaaattgaagaaggaactggttcaggctgtgcacgataatcaggttttggttgtcata
ggtgagactggttcaggtaagacaactcaggtgacgcagtatctagccgaagcaggttac
accaccaggggtaagataggatgcacccagccccgtagggtggctgcaatgtctgtggcc
aagagagttgctgaagagtttggttgccgtttaggggaggaagttggatatgccattcgt
tttgaagattgtaccggcccagaaactgtgatcaagtacatgaccgatggtatgcttttg
agggaaattctgatcgacgagaacctatctcaatactcggtgatcatgcttgacgaagct
catgagagaacaatgcatactgatgtcctctttgggttattaaaagatcttgtgaaaaga
agacccgaccttcgtttaatcgtcacttctgccacattggatgccgagaagttttctgcg
tatttctttagctgcaatatcttcacaattcctggaaggacatttcctgtggagatactt
tacaccaaacagccggaaagcgattatcttgatgcagctctaattactgtaatgcagatc
cacttaacagagcctgagggtgatgtgcttgtctttttaacgggtcaggaggaaattgat
catgcttgccagtgtctatatgaaaggatgaaagggttaggtaaaaatgtgcctgaattg
atcatattaccggtttacagtgcacttcctagtgaaatgcaatccagaatctttgaacct
gcccctcctgggaagaggaaggtggttgttgccaccaatattgctgaagcttctttaaca
attgatgggattttctatgttattgaccctggatttgctaagcaaaatgtgtataaccct
aaacagggtcttgattcacttgtgattactccaatatctcaggcgtcagcaaagcaaaga
gccgggcgtgcaggccgtacagggcccggaaagtgttacagactatacaccgaaagtgct
ttcaacaacgagatgtctcctacctcaattcccgaaattcaaaggataaatcttggattg
ataactttgaatttgaaagctatggggataaacgatcttctttctttcgatttcatggac
ccaccttctccgcaagctctaatttctgctatggaacagctctacagtcttggagctctt
gatgaagaggggcttctaaccaaattgggtcggaaaatggcagagttcccactggatcct
ccattgtcaaagatgcttcttgctagtgttgatttgggttgtagtgatgagattttgact
atcatagctatgattcaaaccgggaacatcttctacagaccaagggaaaagcaggcacaa
gcagatcaaagaagggccaagttctttcaacctgaaggagatcatctgactttgcttgct
gtttatgaagcttggaaagccaagaacttttctgggccatggtgttttgagaattttgtt
caggctagatcactaaggagggcgcaagatgttaggaagcagcttttatcgatcatggac
aagtacaaattggacgtcgtgagtgccgggaagaactttacaaagatccgaaaggcaatt
acagccggttttttcttccatgctgcccggaaggacccacaagaaggataccgaactata
gtcgagaaccagcctgtttatatacacccaagtagcgcccttttccagcgtcaacccgat
tgggtgatctatcacgagctagtcatgacaacaaaagaatacatgcgtgaagttgcggtc
gtggatccaaaatggctagtcgaacttgcaccaagattctttaaagtgtcggatcccaca
aagatgagcaagcggaagcgccaagaacggattgaacctctttacgatcggtaccacgaa
cccaattcatggcggttgagtaagcgccgtgcgtga

DBGET integrated database retrieval system