KEGG   Cynara cardunculus var. scolymus (artichoke): 112517290Help
Entry
112517290         CDS       T05604                                 

Definition
(RefSeq) calmodulin-binding receptor-like cytoplasmic kinase 3 isoform X1
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal APH ABC1
Motif
Other DBs
NCBI-GeneID: 112517290
NCBI-ProteinID: XP_024980441
Position
LG 8
AA seq 493 aa AA seqDB search
MLAVLSFLLLMQLSVISTSGLLHTEACGSHHIRHSSDSGHELFFYDGELVDKDFFCKFIK
LYIANHCFISRFIVNQCFEGDLFSDGLPAKVERRFLRYLVIKETRGSVFSAKYTAMGAPG
LLLLCCTSFFCCFRSKKKDTDDVVLVKESNSMDSAPSVEMNSVSGKTPASPLRVPQSPGR
FSMSPKLDRIGSVHLTMNQVARATQNFSPSLKLGEGGFGTVYKAQLQDGRMVAIKRASKE
RSDALRSEFRSEIELLAKIEHRNLVKLLGYVDKGNERLIITEFVPNGTLRDHLDGIHGGC
LDFSQRLEISIDIAHGLTYLHLYSEKQIIHRDVKSSNILLTDTMRAKVADFGFARLGGTE
TGKTHVVTKVKGTVGYLDPEYMRTFQLTPKSDVYSFGVLLVEILTGRRPVESRRFPDEKI
TIRWAFGKHTKGETMDLVDPQMMEGVDGEIFEKMLSLAFQCVAPTRADRPDMKSVGEQLW
AIRMDYLKHGRRE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgctagctgtattgagttttctactattgatgcaattatcggtcatatctacctctgga
ttgttgcatactgaggcttgtggatcgcatcatattcgccattcgagtgattctggtcat
gagttgtttttctatgatggagaattggtagataaagatttcttctgcaaattcatcaag
ttatacattgcaaatcactgcttcatcagtagattcattgtgaatcaatgctttgaaggg
gatcttttttcagatggtttacccgcgaaggttgagaggagatttttgcgctatttggtt
ataaaagagactcgaggatccgtgtttagcgcaaaatatacagccatgggtgcaccagga
ctcttgcttctatgttgcaccagttttttttgctgttttcgatctaaaaagaaggatact
gatgatgttgttcttgttaaggagtcgaattcaatggattcagctccgtctgtagaaatg
aattcggtgtctggaaagactccagcaagtccactacgagttccacagagtcctggtaga
ttctcgatgtcgccgaagctcgataggattggatcggttcatctaacaatgaatcaagtt
gcaagagctacacaaaacttttcaccatcattgaagttgggtgaaggaggatttggaacc
gtatataaagctcaactacaagatggtcgaatggtcgctataaaaagagcaagcaaggaa
cgctccgatgctttacgaagtgaatttagaagtgagattgagttacttgcgaagattgaa
catcgaaatctagtaaaattgcttggttacgtagataaaggaaacgagcgccttattatt
acagagtttgtgcctaatggtacacttagagatcatttagatggtattcacggaggttgc
ttagatttcagtcaacggcttgaaatttccatcgatattgctcacggcttaacgtacctt
catttatactcagaaaaacaaataatccaccgagatgtgaaatcgtcgaacatccttctg
acggatacgatgcgagctaaagtggccgatttcggatttgcgaggcttgggggtactgag
accggtaaaacacatgttgtaaccaaagtgaaagggacggttggctaccttgatccggag
tatatgagaacctttcaactcaccccaaagagcgacgtgtactctttcggggttttactg
gtagaaattcttacgggtcgtcgacctgtcgaatcgaggcggtttccggacgagaagatc
acgattagatgggcattcgggaaacacaccaaaggcgaaacgatggatttggtggacccg
caaatgatggaaggggtggacggggagatcttcgaaaagatgttaagcctggcgtttcaa
tgcgtggcccccacacgagctgatcggcctgatatgaagtccgtgggagagcagttgtgg
gcgatacgaatggactatcttaaacatggaagaagagagtga

DBGET integrated database retrieval system