KEGG   Cynara cardunculus var. scolymus (artichoke): 112517997Help
Entry
112517997         CDS       T05604                                 

Definition
(RefSeq) beta-caryophyllene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    112517997
Enzymes [BR:ccav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     112517997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 112517997
NCBI-ProteinID: XP_024981250
Position
LG 9
AA seq 545 aa AA seqDB search
MSAEQEEXVRPLRQIPPCVWGDQFANYDKKPKQVEVEQIVIDLKEEVRKDISAALDVPTQ
HTNLLKLIDAIQRLGISYYFQDDIEKALQHIYDTYGDDWTGDSVSIWFRLLRQHGFYVSC
DIFDSYKDANGCFNESLTNDVQGLLELYEASYMRVQGEVVLDDALAFTRSRLRNVVIKDP
LCSDSTRIREALEQPILKRLPRLEALRYIPFYQEEVSHNESLLKLAKIGFNLLQSLHKEE
LSQVSKWWKGFDIPNKLSYVRDRVVECYFWSLAVYFGPQYSRARIFVAKVVLMATILDDT
YDAYGTYEELEIFTEAAQRWSITCLDMLPEYMKPIYQGLLDMYKEMEEIMEMEGKTHHVK
HAIEFMKEYIRGYMMEAKWVHEGYVPTMEEHESVTHVTAGNTMLTAACFLGMGDMVTDES
FKWVYTRPPLCKDACAVARLMDDIITHKKEKERKHVASSVETYMNRYDVSEEHARDLLYE
RVEDVWKNIVRESLVCKDVPMPLITCVINLARVIDVIYKDKDHFTYVGEVMKGYIRSLFV
HPMSI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgaacaagaggaagytgttcgtccccttcggcaaattcctccatgtgtgtgg
ggagatcaatttgcgaactacgacaagaaaccaaagcaagtggaggttgaacaaattgtc
atagatttgaaagaagaagtgaggaaagatatatcggcagctttggatgttccgacacag
catactaatttgttaaagctgattgatgcaatccaacgccttggcataagctattacttc
caagacgatattgagaaagccttgcaacatatttacgacacgtacggcgatgattggacc
ggtgatagcgtgtccatttggttcaggctcttgcgacaacacggcttctatgtttcatgt
gatatcttcgacagttataaggacgcaaacggatgttttaacgaatcgttaaccaatgat
gttcaaggcctgcttgagttgtacgaggcgtcgtatatgagggtgcaaggcgaagttgta
ctagatgatgctcttgcttttacaagatctcgtcttcgcaatgtagtcattaaggatcct
ctttgcagcgactcaacccgaatacgagaggccctagagcaaccgatactgaaacgattg
ccgagactagaggcgttacgctacattcctttctaccaagaagaagtttcacataacgag
tccttacttaaacttgccaagatagggttcaacctgcttcaatcactccacaaagaggag
cttagccaagtttccaagtggtggaaaggtttcgatatcccgaacaagttatcgtatgta
agagatagagtggtggaatgctatttttggtcattggccgtctactttggacctcaatac
tctcgagctcgaattttcgtagctaaagtggttttgatggcaacgattcttgatgacact
tatgatgcttatggtacttatgaagaacttgagatctttactgaagcggctcaaaggtgg
tcgattacgtgcttagatatgcttccagaatacatgaaaccgatatatcaaggactcctg
gatatgtacaaagaaatggaagaaatcatggaaatggaaggaaaaacgcatcatgttaag
catgccatagagtttatgaaagagtatattagaggctacatgatggaagcgaaatgggta
cacgaggggtatgtaccaacaatggaggagcacgaatcagttactcatgtaactgctgga
aataccatgcttacagcagcatgttttcttggaatgggtgatatggtcacagatgaatcc
ttcaaatgggtttacacaagaccccctctttgtaaggatgcatgtgcagttgctagactc
atggatgatatcatcacccacaagaaagagaaagaaagaaagcatgttgcatctagtgtt
gaaacttacatgaatcgatacgatgtctcggaggagcatgcccgtgatttgttgtacgaa
agagttgaagatgtgtggaaaaatattgtgcgcgagtcgctcgtatgcaaagatgttccg
atgcctctaataacctgcgtgatcaacttggcacgggtgatagatgttatctataaagac
aaagatcatttcacgtatgtgggagaagtaatgaaaggctatattagatcattgttcgtg
catcccatgagcatatga

DBGET integrated database retrieval system