KEGG   Cynara cardunculus var. scolymus (artichoke): 112518699Help
Entry
112518699         CDS       T05604                                 

Definition
(RefSeq) ceramide kinase-like
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    112518699
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     112518699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 112518699
NCBI-ProteinID: XP_024982258
Position
LG 1
AA seq 613 aa AA seqDB search
MDSLSLMRDDDSQANTQYIGGEEPSILTSNFFLDHVGEVSLTLKPDGLSWKLMESLCNDQ
ADGSTCLGIQIVSKSDTSINISDVYTVEFIDWGLVHETLLTNPGLLLGHSSEMYRFTVHG
VERSKSQPSLWAPTVYTFGHVDKQTCLMWVNRMKTFLSMETDRPKNLLVYVHPGSGKGNG
CRTWESLAPIFSQAKVKTKVIVTERAGHAFEAVTSMTNRELNLYDGVVAVGGDGFFNEIL
NGILLSRHRAPYPPPPPDDDQTVETESNVLLHDPTVTVVEPSVSGEDESALLLRPPLDQS
QAIDLSIGSNSSNKDQDSEISFPNERFRFGLIPSGSTDAIVICTTGVRDPMTSALQIILG
KRVSLDIAQVVRWEKSSKSKNKPLVRYAASFAGYGFYGDVITESEKYRWMGPKRYDYAGT
KVFLRHRSYEAKVAYMKVESEKPNVGANARRIKTFWGLSKKSERLPCRAKCDICNTSSAI
PQIETPDPHQESNWVRVKGRFLSIGAAVISCRNERAPDGLVADAHLSDGFLHLVLIKDCS
HAFYLWHLTQLARKGGTPLNFDFVEHHKTTTFTFTSSGEESVWNVDGEILKAQKLSAQVF
RGLISLFASGPET
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggattctctctctctcatgagagacgatgattctcaagcaaatacccaatatattggt
ggtgaagaaccgtcgattttgacttcgaatttcttcttggatcatgttggagaggtttct
cttacccttaaaccagacgggttatcatggaaattaatggaatccctttgcaatgaccag
gcagatgggtcaacttgtttaggaatacaaattgtctccaaaagtgatacctcaatcaac
atttcagatgtgtacactgttgaatttatagattgggggttggtacatgaaacccttctc
acaaaccctggattgttattgggtcattcatctgagatgtatcgtttcacggtgcatggt
gtcgagaggtccaagtctcagccttctctttgggctccaactgtgtacacttttggtcat
gtggataagcaaacatgtctaatgtgggtgaacaggatgaaaacttttctaagcatggaa
accgaccggcctaagaatcttctggtttacgttcatccgggaagtggaaaaggaaatggt
tgtcgaacttgggaaagtttagctcctatcttttcacaagccaaagtgaaaacaaaggtt
attgttacagaaagggctgggcatgcttttgaggctgtgacttctatgacaaacagggag
cttaatttgtatgacggagttgtagctgtcggtggtgatggattttttaacgagattctt
aacggaattctcttgtcaagacatagagctccttatccacctccccctccagatgatgat
caaactgttgaaacagaaagtaacgtattgcttcatgatccaactgtaactgttgtggag
ccttcggtttctggtgaggatgagtctgctcttctcttaaggccgccactcgatcaatca
caagccatagatctcagcatcggaagtaattcttccaacaaagatcaagattctgaaata
tctttcccaaatgagcgatttcgatttggactgattccttctggttccactgatgctatt
gtaatatgcacaactggagttcgggatcctatgacgtcagcgcttcaaattatcttgggt
aaaagggtatctcttgatatagctcaagtcgtgagatgggaaaagtcaagcaagtccaag
aacaagcctcttgtacgctatgcagcttcctttgctggttatggattttatggagatgtg
attacagagagcgagaaatatcgctggatggggccaaagcgatatgattatgcagggaca
aaggtgttcctcaggcacaggtcatatgaggccaaagtagcatatatgaaagttgaatca
gaaaaaccgaatgtgggtgccaatgcaagaaggataaagactttttggggcttatctaaa
aagtcggaaagactgccttgtcgtgctaaatgtgatatttgtaacactagttcagccatc
ccacaaatagaaacaccagacccgcatcaagaatcaaattgggtgagagttaaaggacgg
tttcttagcattggggctgctgtaatctcttgtcgaaatgaaagagcacccgatggtttg
gttgctgatgcacacctttcagatgggtttttgcatcttgttttgatcaaagattgctct
catgctttctatctatggcatctcacccagttagcaagaaagggtggaacccctctgaat
tttgatttcgttgaacaccataaaactacaactttcacattcacttcttctggggaggag
agcgtgtggaatgtggatggcgagatccttaaagcacaaaaactctctgcacaagtcttt
cgtggccttattagtttgtttgcttctggccctgaaacgtag

DBGET integrated database retrieval system