KEGG   Cynara cardunculus var. scolymus (artichoke): 112519030Help
Entry
112519030         CDS       T05604                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00630  Glyoxylate and dicarboxylate metabolism
ccav00710  Carbon fixation in photosynthetic organisms
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
Module
ccav_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ccav_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ccav_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    112519030
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    112519030
Enzymes [BR:ccav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     112519030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 112519030
NCBI-ProteinID: XP_024982702
Position
LG 10
AA seq 179 aa AA seqDB search
MASISSSAVATVNRNASAQASLVAPFTGLKSNVAFPVTKKANDFSSLPSNGGRVQCMKVW
PPLGLKKYETLSYLPPLSEASLAKEVDYLLRNKWVPCLEFELEHGFVYREHHSSPGYYDG
RYWTMWKLPMFGCTDSAQVLKELEEVKKEYPNAFVRIIGFDNVRQVQCVSFIAAKPPGY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatctcctcctccgcggtcgcaaccgtcaaccggaacgcctccgctcaagcc
agcttggtggctccatttaccggcctcaagtccaacgtcgccttccccgttaccaagaag
gccaacgacttttcctcccttcccagcaacggtggaagagttcaatgcatgaaggtgtgg
ccaccccttggattgaagaagtacgagaccctttcgtacctaccgccactaagtgaagca
tcgttggccaaggaagtcgactacctactccgcaacaaatgggttccttgtttggaattc
gagttggagcacggttttgtctaccgtgagcaccactcatcgcccggatactatgacgga
agatactggacaatgtggaagttgcccatgttcgggtgcactgactcagcccaggtgttg
aaggagctcgaagaggtcaagaaggagtaccccaacgccttcgtccgtattatcggattc
gacaacgtccgtcaagtccagtgtgtgagtttcattgctgccaaaccaccaggctactaa

DBGET integrated database retrieval system